+ USE_DATABASE_REPLICATED=0 + USE_SHARED_CATALOG=0 ++ rg -v '#' /usr/share/zoneinfo/zone.tab ++ awk '{print $3}' ++ shuf ++ head -n1 + TZ=America/Tijuana + echo 'Chosen random timezone America/Tijuana' + ln -snf /usr/share/zoneinfo/America/Tijuana /etc/localtime Chosen random timezone America/Tijuana + echo America/Tijuana + dpkg -i package_folder/clickhouse-common-static_24.8.14.10550.altinitytest+ubsan_amd64.deb Selecting previously unselected package clickhouse-common-static. (Reading database ... 48429 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static_24.8.14.10550.altinitytest+ubsan_amd64.deb ... Unpacking clickhouse-common-static (24.8.14.10550.altinitytest+ubsan) ... Setting up clickhouse-common-static (24.8.14.10550.altinitytest+ubsan) ... + dpkg -i package_folder/clickhouse-common-static-dbg_24.8.14.10550.altinitytest+ubsan_amd64.deb Selecting previously unselected package clickhouse-common-static-dbg. (Reading database ... 48456 files and directories currently installed.) Preparing to unpack .../clickhouse-common-static-dbg_24.8.14.10550.altinitytest+ubsan_amd64.deb ... Unpacking clickhouse-common-static-dbg (24.8.14.10550.altinitytest+ubsan) ... Setting up clickhouse-common-static-dbg (24.8.14.10550.altinitytest+ubsan) ... + dpkg -i package_folder/clickhouse-odbc-bridge_24.8.14.10550.altinitytest+ubsan_amd64.deb Selecting previously unselected package clickhouse-odbc-bridge. (Reading database ... 48463 files and directories currently installed.) Preparing to unpack .../clickhouse-odbc-bridge_24.8.14.10550.altinitytest+ubsan_amd64.deb ... Unpacking clickhouse-odbc-bridge (24.8.14.10550.altinitytest+ubsan) ... Setting up clickhouse-odbc-bridge (24.8.14.10550.altinitytest+ubsan) ... + dpkg -i package_folder/clickhouse-library-bridge_24.8.14.10550.altinitytest+ubsan_amd64.deb Selecting previously unselected package clickhouse-library-bridge. (Reading database ... 48469 files and directories currently installed.) Preparing to unpack .../clickhouse-library-bridge_24.8.14.10550.altinitytest+ubsan_amd64.deb ... Unpacking clickhouse-library-bridge (24.8.14.10550.altinitytest+ubsan) ... Setting up clickhouse-library-bridge (24.8.14.10550.altinitytest+ubsan) ... + dpkg -i package_folder/clickhouse-server_24.8.14.10550.altinitytest+ubsan_amd64.deb Selecting previously unselected package clickhouse-server. (Reading database ... 48475 files and directories currently installed.) Preparing to unpack .../clickhouse-server_24.8.14.10550.altinitytest+ubsan_amd64.deb ... Unpacking clickhouse-server (24.8.14.10550.altinitytest+ubsan) ... Setting up clickhouse-server (24.8.14.10550.altinitytest+ubsan) ... ClickHouse binary is already located at /usr/bin/clickhouse Symlink /usr/bin/clickhouse-server already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-server to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-client to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-local to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-benchmark to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-obfuscator to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-git-import to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-compressor to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-format to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-extract-from-config already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-extract-from-config to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper to /usr/bin/clickhouse. Symlink /usr/bin/clickhouse-keeper-converter already exists but it points to /clickhouse. Will replace the old symlink to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-keeper-converter to /usr/bin/clickhouse. Creating symlink /usr/bin/clickhouse-disks to /usr/bin/clickhouse. Creating symlink /usr/bin/ch to /usr/bin/clickhouse. Creating symlink /usr/bin/chl to /usr/bin/clickhouse. Creating symlink /usr/bin/chc to /usr/bin/clickhouse. Creating clickhouse group if it does not exist. groupadd -r clickhouse Creating clickhouse user if it does not exist. useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse clickhouse Will set ulimits for clickhouse user in /etc/security/limits.d/clickhouse.conf. Creating config directory /etc/clickhouse-server/config.d that is used for tweaks of main server configuration. Creating config directory /etc/clickhouse-server/users.d that is used for tweaks of users configuration. Config file /etc/clickhouse-server/config.xml already exists, will keep it and extract path info from it. /etc/clickhouse-server/config.xml has /var/lib/clickhouse/ as data path. /etc/clickhouse-server/config.xml has /var/log/clickhouse-server/ as log path. Users config file /etc/clickhouse-server/users.xml already exists, will keep it and extract users info from it. Log directory /var/log/clickhouse-server/ already exists. Creating data directory /var/lib/clickhouse/. Creating pid directory /var/run/clickhouse-server. chown -R clickhouse:clickhouse '/var/log/clickhouse-server/' chown -R clickhouse:clickhouse '/var/run/clickhouse-server' chown clickhouse:clickhouse '/var/lib/clickhouse/' groupadd -r clickhouse-bridge useradd -r --shell /bin/false --home-dir /nonexistent -g clickhouse-bridge clickhouse-bridge chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-odbc-bridge' chown -R clickhouse-bridge:clickhouse-bridge '/usr/bin/clickhouse-library-bridge' Password for the default user is an empty string. See /etc/clickhouse-server/users.xml and /etc/clickhouse-server/users.d to change it. Setting capabilities for clickhouse binary. This is optional. chown -R clickhouse:clickhouse '/etc/clickhouse-server' ClickHouse has been successfully installed. Start clickhouse-server with: sudo clickhouse start Start clickhouse-client with: clickhouse-client + dpkg -i package_folder/clickhouse-client_24.8.14.10550.altinitytest+ubsan_amd64.deb Selecting previously unselected package clickhouse-client. (Reading database ... 48492 files and directories currently installed.) Preparing to unpack .../clickhouse-client_24.8.14.10550.altinitytest+ubsan_amd64.deb ... Unpacking clickhouse-client (24.8.14.10550.altinitytest+ubsan) ... Setting up clickhouse-client (24.8.14.10550.altinitytest+ubsan) ... + echo '' + [[ -z '' ]] + ch --query 'SELECT 1' 1 + chl --query 'SELECT 1' 1 + chc --version ClickHouse client version 24.8.14.10550.altinitytest (altinity build). + ln -s /usr/share/clickhouse-test/clickhouse-test /usr/bin/clickhouse-test + source /attach_gdb.lib ++ source /utils.lib +++ sysctl kernel.core_pattern=core.%e.%p-%P kernel.core_pattern = core.%e.%p-%P +++ sysctl fs.suid_dumpable=1 fs.suid_dumpable = 1 + source /utils.lib ++ sysctl kernel.core_pattern=core.%e.%p-%P kernel.core_pattern = core.%e.%p-%P ++ sysctl fs.suid_dumpable=1 fs.suid_dumpable = 1 + /usr/share/clickhouse-test/config/install.sh + DEST_SERVER_PATH=/etc/clickhouse-server + DEST_CLIENT_PATH=/etc/clickhouse-client +++ dirname /usr/share/clickhouse-test/config/install.sh ++ cd /usr/share/clickhouse-test/config ++ pwd -P + SRC_PATH=/usr/share/clickhouse-test/config + echo 'Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server' Going to install test configs from /usr/share/clickhouse-test/config into /etc/clickhouse-server + mkdir -p /etc/clickhouse-server/config.d/ + mkdir -p /etc/clickhouse-server/users.d/ + mkdir -p /etc/clickhouse-client + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_write.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_num_to_warn.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/listen.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/text_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/blob_storage_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_settings_prefixes.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_catalog_drop_table_concurrency.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_access_control_improvements.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/macros.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/secure_ports.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/clusters.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/graphite_alternative.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/grpc_protocol.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/database_atomic.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/max_concurrent_queries.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_settings.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backoff_failed_mutation.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree_old_dirs_cleanup.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/test_cluster_with_incorrect_pw.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/keeper_port.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logging_no_rotate.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/merge_tree.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/lost_forever_check.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/tcp_with_proxy.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/prometheus.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_lists.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/top_level_domains_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/transactions.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/encryption.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/CORS.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/logger_trace.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/named_collection.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/ssl_certs.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_cache_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/session_log.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/system_unfreeze.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_zero_copy_replication.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/nlp.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/forbidden_headers.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_keeper_map.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/custom_disks_base_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/display_name.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/compressed_marks_and_index.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/disable_s3_env_credentials.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/enable_wait_for_shutdown_replicated_tables.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/backups.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/filesystem_caches_path.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/validate_tcp_client_information.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/zero_copy_destructive_operations.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/block_number.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/handlers.yaml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/serverwide_trace_collector.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/rocksdb.xml /etc/clickhouse-server/config.d/ + '[' /etc/clickhouse-server = /etc/clickhouse-server ']' + ln -sf /usr/share/clickhouse-test/config/config.d/legacy_geobase.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/log_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/readonly.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/access_management.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/database_atomic_drop_detach_sync.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/opentelemetry.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/remote_queries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/session_log_test.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/memory_profiler.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/no_fsync_metadata.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/filelog.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/enable_blobs_check.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/marks.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/insert_keeper_retries.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/prefetch_settings.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/nonconst_timezone.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/allow_introspection_functions.yaml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/replicated_ddl_entry.xml /etc/clickhouse-server/users.d/ + [[ -n '' ]] + ln -sf /usr/share/clickhouse-test/config/users.d/timeouts.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/ints_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/strings_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/decimals_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/executable_pool_dictionary.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/test_function.xml /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/top_level_domains /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/regions_hierarchy.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/regions_names_en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-en.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/ext-ru.txt /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/lem-en.bin /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/server.key /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/server.crt /etc/clickhouse-server/ + ln -sf /usr/share/clickhouse-test/config/dhparam.pem /etc/clickhouse-server/ + ln -sf --backup=simple --suffix=_original.xml /usr/share/clickhouse-test/config/config.d/query_masking_rules.xml /etc/clickhouse-server/config.d/ + [[ -n '' ]] + rm -f /etc/clickhouse-server/config.d/zookeeper_fault_injection.xml + ln -sf /usr/share/clickhouse-test/config/config.d/zookeeper.xml /etc/clickhouse-server/config.d/ + [[ -n '' ]] + rm -f /etc/clickhouse-server/config.d/cannot_allocate_thread_injection.xml + value=0 + sed --follow-symlinks -i 's|[01]|0|' /etc/clickhouse-server/config.d/keeper_port.xml + value=3610624 + sed --follow-symlinks -i 's|[[:digit:]]\+|3610624|' /etc/clickhouse-server/config.d/keeper_port.xml + value=54464512 + sed --follow-symlinks -i 's|[[:digit:]]\+|54464512|' /etc/clickhouse-server/config.d/keeper_port.xml + [[ -n '' ]] + [[ -n '' ]] + [[ '' == \1 ]] + [[ '' == \1 ]] + [[ -n 1 ]] + ln -sf /usr/share/clickhouse-test/config/config.d/azure_storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02944.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02963.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/config.d/storage_conf_02961.xml /etc/clickhouse-server/config.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache.xml /etc/clickhouse-server/users.d/ + ln -sf /usr/share/clickhouse-test/config/users.d/s3_cache_new.xml /etc/clickhouse-server/users.d/ + [[ -n 0 ]] + [[ 0 -eq 1 ]] + ln -sf /usr/share/clickhouse-test/config/client_config.xml /etc/clickhouse-client/config.xml + [[ -n 0 ]] + [[ 0 -eq 1 ]] + ./setup_minio.sh stateless + azurite-blob --blobHost 0.0.0.0 --blobPort 10000 --debug /azurite_log + export MINIO_ROOT_USER=clickhouse + MINIO_ROOT_USER=clickhouse + export MINIO_ROOT_PASSWORD=clickhouse + MINIO_ROOT_PASSWORD=clickhouse + main stateless + local query_dir ++ check_arg stateless ++ local query_dir ++ '[' '!' 1 -eq 1 ']' ++ case "$1" in ++ query_dir=0_stateless ++ echo 0_stateless + query_dir=0_stateless + '[' '!' -f ./minio ']' + start_minio + mkdir -p ./minio_data + ./minio --version minio version RELEASE.2024-08-03T04-33-23Z (commit-id=6efb56851c40da88d1ca15112e2d686a4ecec6b3) Runtime: go1.22.5 linux/amd64 License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Copyright: 2015-2024 MinIO, Inc. + wait_for_it + local counter=0 + local max_counter=60 + local url=http://localhost:11111 + params=('--silent' '--verbose') + local params + ./minio server --address :11111 ./minio_data + curl --silent --verbose http://localhost:11111 + grep AccessDenied + [[ 0 == \6\0 ]] + echo 'trying to connect to minio' + sleep 1 trying to connect to minio Azurite Blob service is starting on 0.0.0.0:10000 Azurite Blob service successfully listens on http://0.0.0.0:10000 INFO: Formatting 1st pool, 1 set(s), 1 drives per set. INFO: WARNING: Host local has more than 0 drives of set. A host failure will result in data becoming unavailable. MinIO Object Storage Server Copyright: 2015-2026 MinIO, Inc. License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64) API: http://172.17.0.2:11111 http://127.0.0.1:11111 WebUI: http://172.17.0.2:45597 http://127.0.0.1:45597 Docs: https://min.io/docs/minio/linux/index.html + counter=1 + curl --silent --verbose http://localhost:11111 + grep AccessDenied AccessDeniedAccess Denied./18E35CAB563409FC7dc7eb22d3288ec80374614e9088e31d3668a6922ead55932dd2a8e56373820f + lsof -i :11111 COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME minio 283 root 8u IPv6 23196 0t0 TCP *:11111 (LISTEN) minio 283 root 9u IPv4 23195 0t0 TCP localhost:11111 (LISTEN) minio 283 root 10u IPv6 23197 0t0 TCP localhost:11111 (LISTEN) + sleep 5 + setup_minio stateless + local test_type=stateless + ./mc alias set clickminio http://localhost:11111 clickhouse clickhouse Added `clickminio` successfully. + ./mc admin user add clickminio test testtest Added user `test` successfully. + ./mc admin policy attach clickminio readwrite --user=test Attached Policies: [readwrite] To User: test + ./mc mb --ignore-existing clickminio/test Bucket created successfully `clickminio/test`. + '[' stateless = stateless ']' + ./mc anonymous set public clickminio/test Access permission for `clickminio/test` is set to `public` + upload_data 0_stateless /usr/share/clickhouse-test + local query_dir=0_stateless + local test_path=/usr/share/clickhouse-test + local data_path=/usr/share/clickhouse-test/queries/0_stateless/data_minio + '[' -d /usr/share/clickhouse-test/queries/0_stateless/data_minio ']' + ./mc cp --recursive /usr/share/clickhouse-test/queries/0_stateless/data_minio/ clickminio/test/ `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.tar` -> `clickminio/test/03036_archive1.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.arrow` -> `clickminio/test/02731.arrow` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02731.parquet` -> `clickminio/test/02731.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02876.parquet` -> `clickminio/test/02876.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive1.zip` -> `clickminio/test/03036_archive1.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.tar` -> `clickminio/test/03036_archive2.tar` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/02366_data.jsonl` -> `clickminio/test/02366_data.jsonl` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive2.zip` -> `clickminio/test/03036_archive2.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_archive3.tar.gz` -> `clickminio/test/03036_archive3.tar.gz` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_compressed_file_archive.zip` -> `clickminio/test/03036_compressed_file_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/03036_json_archive.zip` -> `clickminio/test/03036_json_archive.zip` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/a.tsv` -> `clickminio/test/a.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/b.tsv` -> `clickminio/test/b.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/c.tsv` -> `clickminio/test/c.tsv` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Gordon/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/column1=Schmidt/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/column0=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/column0=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` -> `clickminio/test/hive_partitioning/non_existing_column=Elizabeth/sample.parquet` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/json_data` -> `clickminio/test/json_data` `/usr/share/clickhouse-test/queries/0_stateless/data_minio/tsv_with_header.tsv` -> `clickminio/test/tsv_with_header.tsv` Total: 5.42 MiB, Transferred: 5.42 MiB, Speed: 105.67 MiB/s + setup_aws_credentials + local minio_root_user=clickhouse + local minio_root_password=clickhouse + mkdir -p /root/.aws + cat + ./setup_hdfs_minicluster.sh + ls -lha total 125M drwxr-xr-x 1 root root 4.0K Oct 30 09:49 . drwxr-xr-x 1 root root 4.0K Oct 30 09:49 .. -rw-rw-r-- 1 1000 1000 119 Oct 30 09:45 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2.4K Jul 22 16:40 attach_gdb.lib -rw-r--r-- 1 root root 53 Oct 30 09:49 AzuriteConfig -rw-r--r-- 1 root root 1.3K Oct 30 09:49 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 3.9K Oct 30 09:49 __azurite_db_blob__.json -rw-r--r-- 1 root root 1.6K Oct 30 09:49 azurite_log lrwxrwxrwx 1 root root 7 Apr 9 2026 bin -> usr/bin drwxr-xr-x 2 root root 4.0K Oct 30 09:49 __blobstorage__ drwxr-xr-x 2 root root 4.0K Apr 18 2022 boot -rw-rw-r-- 1 1000 1000 2.1K Oct 30 09:45 broken_tests.json drwxr-xr-x 14 root root 3.8K Oct 30 09:48 dev -rwxr-xr-x 1 root root 0 Oct 30 09:48 .dockerenv drwxr-xr-x 1 root root 4.0K Oct 30 09:49 etc drwxr-xr-x 10 1000 1000 4.0K Jun 14 2021 hadoop-3.3.1 drwxr-xr-x 2 root root 4.0K Apr 18 2022 home lrwxrwxrwx 1 root root 7 Apr 9 2026 lib -> usr/lib lrwxrwxrwx 1 root root 9 Apr 9 2026 lib32 -> usr/lib32 lrwxrwxrwx 1 root root 9 Apr 9 2026 lib64 -> usr/lib64 lrwxrwxrwx 1 root root 10 Apr 9 2026 libx32 -> usr/libx32 -rwxr-xr-x 1 root root 26M Jul 22 16:42 mc drwxr-xr-x 2 root root 4.0K Apr 9 2026 media -rwxr-xr-x 1 root root 99M Jul 22 16:42 minio drwxr-xr-x 4 root root 4.0K Oct 30 09:49 minio_data drwxr-xr-x 2 root root 4.0K Apr 9 2026 mnt drwxr-xr-x 1 root root 4.0K May 6 08:02 opt -rw-r--r-- 1 root root 0 Mar 24 2026 .package-cache-mutate drwxrwxr-x 2 1000 1000 4.0K Oct 30 09:48 package_folder dr-xr-xr-x 310 root root 0 Oct 30 09:48 proc -rwxrwxr-x 1 root root 11K May 6 08:01 process_functional_tests_result.py -rw-rw-r-- 1 root root 837 Jul 22 16:40 requirements.txt drwx------ 1 root root 4.0K Oct 30 09:49 root drwxr-xr-x 1 root root 4.0K Oct 30 09:49 run -rwxrwxr-x 1 root root 22K Jul 22 16:40 run.sh lrwxrwxrwx 1 root root 8 Apr 9 2026 sbin -> usr/sbin -rwxrwxr-x 1 root root 11K May 6 08:10 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Jul 22 16:40 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3.4K Jul 22 16:40 setup_minio.sh drwxr-xr-x 2 root root 4.0K Apr 9 2026 srv -rw-rw-r-- 1 root root 14K Jul 22 16:40 stress_tests.lib dr-xr-xr-x 13 root root 0 Oct 30 09:48 sys drwxrwxr-x 2 1000 1000 4.0K Oct 30 09:48 test_output drwxrwxrwt 1 root root 4.0K Jul 22 16:42 tmp drwxr-xr-x 1 root root 4.0K Apr 9 2026 usr -rw-rw-r-- 1 root root 897 Jul 22 16:40 utils.lib drwxr-xr-x 1 root root 4.0K Apr 9 2026 var + cd hadoop-3.3.1 + export JAVA_HOME=/usr + JAVA_HOME=/usr + mkdir -p target/test/data + chown clickhouse ./target/test/data + nc -z localhost 12222 + sudo -E -u clickhouse bin/mapred minicluster -format -nomr -nnport 12222 + sleep 1 + nc -z localhost 12222 + sleep 1 + nc -z localhost 12222 + lsof -i :12222 COMMAND PID USER FD TYPE DEVICE SIZE/OFF NODE NAME java 410 clickhouse 322u IPv4 46087 0t0 TCP localhost:12222 (LISTEN) java 410 clickhouse 544u IPv4 34517 0t0 TCP localhost:48624->localhost:12222 (ESTABLISHED) java 410 clickhouse 545u IPv4 39303 0t0 TCP localhost:12222->localhost:48624 (ESTABLISHED) + sleep 5 + config_logs_export_cluster /etc/clickhouse-server/config.d/system_logs_export.yaml + set +x File /tmp/export-logs-config.sh does not exist, do not setup + [[ -n '' ]] + export IS_FLAKY_CHECK=0 + IS_FLAKY_CHECK=0 + '[' 1 -gt 1 ']' + sudo -E -u clickhouse /usr/bin/clickhouse-server --config /etc/clickhouse-server/config.xml --daemon --pid-file /var/run/clickhouse-server/clickhouse-server.pid + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for _ in {1..100} + clickhouse-client --query 'SELECT 1' Code: 210. DB::NetException: Connection refused (localhost:9000). (NETWORK_ERROR) + sleep 1 127.0.0.1 - - [30/Oct/2026:16:49:42 +0000] "GET /devstoreaccount1/cont?restype=container HTTP/1.1" 404 - 127.0.0.1 - - [30/Oct/2026:16:49:42 +0000] "PUT /devstoreaccount1/cont?restype=container HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:16:49:42 +0000] "PUT /devstoreaccount1/cont/asljucwvfucirnhbmuocvxceeqvocnyp HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:16:49:42 +0000] "GET /devstoreaccount1/cont/asljucwvfucirnhbmuocvxceeqvocnyp HTTP/1.1" 206 4 127.0.0.1 - - [30/Oct/2026:16:49:42 +0000] "GET /devstoreaccount1/cont/asljucwvfucirnhbmuocvxceeqvocnyp HTTP/1.1" 206 2 127.0.0.1 - - [30/Oct/2026:16:49:42 +0000] "DELETE /devstoreaccount1/cont/asljucwvfucirnhbmuocvxceeqvocnyp HTTP/1.1" 202 - + for _ in {1..100} + clickhouse-client --query 'SELECT 1' 1 + break + setup_logs_replication + set +x File /tmp/export-logs-config.sh does not exist, do not setup + attach_gdb_to_clickhouse ++ run_with_retry 5 clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ [[ ahxB =~ e ]] ++ set_e=false ++ set +e ++ local total_retries=5 ++ shift ++ local retry=0 ++ '[' 0 -ge 5 ']' ++ clickhouse-client --query 'SELECT count() FROM system.build_options WHERE name = '\''CXX_FLAGS'\'' AND position('\''sanitize=address'\'' IN value)' ++ false ++ return + IS_ASAN=0 + [[ 0 = \1 ]] ++ kill -l SIGRTMIN + RTMIN=34 + echo ' set follow-fork-mode parent handle SIGHUP nostop noprint pass handle SIGINT nostop noprint pass handle SIGQUIT nostop noprint pass handle SIGPIPE nostop noprint pass handle SIGTERM nostop noprint pass handle SIGUSR1 nostop noprint pass handle SIGUSR2 nostop noprint pass handle SIG34 nostop noprint pass info signals continue backtrace full info registers p top' 1 KiB of the 'stack: p/x *(uint64_t[128]*)$sp maintenance info sections thread apply all backtrace full disassemble /s up disassemble /s up disassemble /s p "done" detach quit ' + sleep 5 + ts '%Y-%m-%d %H:%M:%S' ++ cat /var/run/clickhouse-server/clickhouse-server.pid + gdb -batch -command script.gdb -p 595 + run_with_retry 60 clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' + [[ aehxB =~ e ]] + set_e=true + set +e + local total_retries=60 + shift + local retry=0 + '[' 0 -ge 60 ']' + clickhouse-client --query 'SELECT '\''Connected to clickhouse-server after attaching gdb'\''' Connected to clickhouse-server after attaching gdb + true + set -e + return + clickhouse-client --query 'CREATE TABLE minio_audit_logs ( log String, event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'') ) ENGINE = MergeTree ORDER BY tuple()' + clickhouse-client --query 'CREATE TABLE minio_server_logs ( log String, event_time DateTime64(9) MATERIALIZED parseDateTime64BestEffortOrZero(trim(BOTH '\''"'\'' FROM JSONExtractRaw(log, '\''time'\'')), 9, '\''UTC'\'') ) ENGINE = MergeTree ORDER BY tuple()' + ./mc admin config set clickminio logger_webhook:ch_server_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_server_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500 Successfully applied new settings. + ./mc admin config set clickminio audit_webhook:ch_audit_webhook 'endpoint=http://localhost:8123/?async_insert=1&wait_for_async_insert=0&async_insert_busy_timeout_min_ms=5000&async_insert_busy_timeout_max_ms=5000&async_insert_max_query_number=1000&async_insert_max_data_size=10485760&query=INSERT%20INTO%20minio_audit_logs%20FORMAT%20LineAsString' queue_size=1000000 batch_size=500 Successfully applied new settings. + max_retries=100 + retry=1 + '[' 1 -le 100 ']' clickminio restart attempt 1: + echo 'clickminio restart attempt 1:' ++ ./mc admin service restart clickminio --wait --json ++ jq -r .status INFO: Restarting on service signal MinIO Object Storage Server Copyright: 2015-2026 MinIO, Inc. License: GNU AGPLv3 - https://www.gnu.org/licenses/agpl-3.0.html Version: RELEASE.2024-08-03T04-33-23Z (go1.22.5 linux/amd64) API: http://172.17.0.2:11111 http://127.0.0.1:11111 WebUI: http://172.17.0.2:37271 http://127.0.0.1:37271 Docs: https://min.io/docs/minio/linux/index.html + output='success success' + echo 'Output of restart status: success success' + expected_output='success success' + '[' 'success success' = 'success success' ']' + echo 'Restarted clickminio successfully.' + break + '[' 1 -gt 100 ']' Output of restart status: success success Restarted clickminio successfully. + MC_ADMIN_PID=1464 + ./mc admin trace clickminio + export -f run_tests + '[' 1 -gt 1 ']' + run_tests + set -x + read -ra ADDITIONAL_OPTIONS + HIGH_LEVEL_COVERAGE=YES + '[' 1 -gt 1 ']' + [[ -n '' ]] + [[ -n '' ]] + [[ 0 -eq 1 ]] + [[ '' -eq 1 ]] + [[ 0 -eq 1 ]] ++ clickhouse-client --query 'SELECT value LIKE '\''%SANITIZE_COVERAGE%'\'' FROM system.build_options WHERE name = '\''CXX_FLAGS'\''' + [[ 1 == 0 ]] + ADDITIONAL_OPTIONS+=('--jobs') + ADDITIONAL_OPTIONS+=('8') + [[ -n 0 ]] + [[ -n 2 ]] + ADDITIONAL_OPTIONS+=('--run-by-hash-num') + ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_NUM") + ADDITIONAL_OPTIONS+=('--run-by-hash-total') + ADDITIONAL_OPTIONS+=("$RUN_BY_HASH_TOTAL") + HIGH_LEVEL_COVERAGE=NO + [[ -n '' ]] + [[ NO = \Y\E\S ]] + ADDITIONAL_OPTIONS+=('--report-logs-stats') + try_run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + local total_retries=10 + shift + fn_exists run_with_retry + declare -F run_with_retry + run_with_retry 10 clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + [[ aehxB =~ e ]] + set_e=true + set +e + local total_retries=10 + shift + local retry=0 + '[' 0 -ge 10 ']' + clickhouse-client -q 'insert into system.zookeeper (name, path, value) values ('\''auxiliary_zookeeper2'\'', '\''/test/chroot/'\'', '\'''\'')' + true + set -e + return + set +e + TEST_ARGS=(--testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs "$NUM_TRIES" "${ADDITIONAL_OPTIONS[@]}") + ts '%Y-%m-%d %H:%M:%S' + tee -a test_output/test_result.txt + clickhouse-test --testname --shard --zookeeper --check-zookeeper-session --hung-check --print-time --no-drop-if-fail --capture-client-stacktrace --test-runs 1 --hung-check --print-time --jobs 8 --run-by-hash-num 0 --run-by-hash-total 2 --report-logs-stats 2026-10-30 09:49:53 Using queries from '/usr/share/clickhouse-test/queries' directory 2026-10-30 09:49:53 Connecting to ClickHouse server... OK 2026-10-30 09:49:53 Connected to server 24.8.14.10550.altinitytest @ 77bb5f60cb900b3241b66f4d944f121e7fd44637 HEAD 2026-10-30 09:49:54 Found 3260 parallel tests and 282 sequential tests 2026-10-30 09:49:54 Running about 407 stateless tests (Process-4). 2026-10-30 09:49:54 03237_max_map_state_decimal_serialization: [ OK ] 0.32 sec. 2026-10-30 09:49:54 Running about 407 stateless tests (Process-7). 2026-10-30 09:49:54 00680_duplicate_columns_inside_union_all: [ OK ] 0.37 sec. 2026-10-30 09:49:54 Running about 407 stateless tests (Process-5). 2026-10-30 09:49:54 01470_columns_transformers2: [ OK ] 0.42 sec. 2026-10-30 09:49:54 Running about 407 stateless tests (Process-9). 2026-10-30 09:49:54 03221_mutate_profile_events: [ OK ] 0.52 sec. 2026-10-30 09:49:54 Running about 407 stateless tests (Process-6). 2026-10-30 09:49:54 02416_rocksdb_delete_update: [ OK ] 0.52 sec. 2026-10-30 09:49:54 Running about 407 stateless tests (Process-8). 2026-10-30 09:49:54 02882_formatQuery: [ OK ] 0.52 sec. 2026-10-30 09:49:54 Running about 407 stateless tests (Process-10). 2026-10-30 09:49:54 02456_bloom_filter_assert: [ OK ] 0.57 sec. 2026-10-30 09:49:54 00999_settings_no_extra_quotes: [ OK ] 0.27 sec. 2026-10-30 09:49:55 02340_analyzer_functions: [ OK ] 0.37 sec. 2026-10-30 09:49:55 01825_type_json_ephemeral: [ OK ] 0.32 sec. 2026-10-30 09:49:55 02971_functions_to_subcolumns_variant: [ OK ] 0.32 sec. 2026-10-30 09:49:55 01036_union_different_columns: [ OK ] 0.27 sec. 2026-10-30 09:49:55 02017_bit_shift_left_for_string_integer: [ OK ] 0.67 sec. 2026-10-30 09:49:55 02911_analyzer_explain_estimate: [ OK ] 0.27 sec. 2026-10-30 09:49:55 01115_join_with_dictionary: [ OK ] 0.57 sec. 2026-10-30 09:49:55 02375_pretty_formats: [ OK ] 0.37 sec. 2026-10-30 09:49:55 01600_remerge_sort_lowered_memory_bytes_ratio: [ OK ] 0.97 sec. 2026-10-30 09:49:55 03032_save_bad_json_escape_sequences: [ OK ] 0.32 sec. 2026-10-30 09:49:55 01414_freeze_does_not_prevent_alters: [ OK ] 0.52 sec. 2026-10-30 09:49:55 02097_initializeAggregationNullable: [ OK ] 0.42 sec. 2026-10-30 09:49:56 02481_analyzer_optimize_aggregation_arithmetics: [ OK ] 0.62 sec. 2026-10-30 09:49:56 02538_alter_rename_sequence: [ OK ] 0.52 sec. 2026-10-30 09:49:56 02016_aggregation_spark_bar: [ OK ] 0.87 sec. 2026-10-30 09:49:56 01284_port: [ OK ] 0.77 sec. 2026-10-30 09:49:56 01670_test_repeat_mysql_dialect: [ OK ] 0.38 sec. 2026-10-30 09:49:56 00833_sleep_overflow: [ OK ] 0.37 sec. 2026-10-30 09:49:56 00632_get_sample_block_cache: [ OK ] 1.88 sec. 2026-10-30 09:49:56 01012_serialize_array_memory_usage: [ OK ] 0.89 sec. 2026-10-30 09:49:56 01529_union_distinct_and_setting_union_default_mode: [ OK ] 0.58 sec. 2026-10-30 09:49:56 00668_compare_arrays_silviucpp: [ OK ] 0.32 sec. 2026-10-30 09:49:57 02787_transform_null: [ OK ] 0.32 sec. 2026-10-30 09:49:57 01825_new_type_json_bools: [ OK ] 0.27 sec. 2026-10-30 09:49:57 01088_array_slice_of_aggregate_functions: [ OK ] 0.27 sec. 2026-10-30 09:49:57 01410_nullable_key_and_index_negate_cond: [ OK ] 0.37 sec. 2026-10-30 09:49:57 01220_scalar_optimization_in_alter: [ OK ] 0.27 sec. 2026-10-30 09:49:57 00971_merge_tree_uniform_read_distribution_and_max_rows_to_read: [ OK ] 0.37 sec. 2026-10-30 09:49:57 01416_clear_column_pk: [ OK ] 0.37 sec. 2026-10-30 09:49:57 02097_remove_sample_by: [ OK ] 0.52 sec. 2026-10-30 09:49:57 02148_cast_type_parsing: [ OK ] 0.27 sec. 2026-10-30 09:49:57 02995_index_9: [ SKIPPED ] 0.00 sec. 2026-10-30 09:49:57 Reason: not running for current build 2026-10-30 09:49:57 01668_avg_weighted_ubsan: [ OK ] 0.32 sec. 2026-10-30 09:49:57 02128_apply_lambda_parsing: [ OK ] 0.27 sec. 2026-10-30 09:49:58 03032_scalars_create_as_select: [ OK ] 0.27 sec. 2026-10-30 09:49:58 00653_monotonic_integer_cast: [ OK ] 0.27 sec. 2026-10-30 09:49:58 02205_postgresql_functions: [ OK ] 0.52 sec. 2026-10-30 09:49:58 01018_ddl_dictionaries_select: [ OK ] 0.57 sec. 2026-10-30 09:49:58 00405_output_format_pretty_color: [ OK ] 0.37 sec. 2026-10-30 09:49:59 00856_no_column_issue_4242: [ OK ] 0.37 sec. 2026-10-30 09:49:59 02122_parallel_formatting_TSV: [ OK ] 3.18 sec. 2026-10-30 09:49:59 01149_zookeeper_mutation_stuck_after_replace_partition: [ OK ] 1.02 sec. 2026-10-30 09:49:59 03011_adaptative_timeout_compatibility: [ OK ] 0.32 sec. 2026-10-30 09:49:59 01079_bit_operations_using_bitset: [ OK ] 0.37 sec. 2026-10-30 09:49:59 03145_unicode_quotes: [ OK ] 0.28 sec. 2026-10-30 09:49:59 01290_max_execution_speed_distributed: [ OK ] 2.62 sec. 2026-10-30 09:49:59 02265_column_ttl: [ OK ] 0.42 sec. 2026-10-30 09:50:00 01592_length_map: [ OK ] 0.27 sec. 2026-10-30 09:50:00 02702_allow_skip_errors_enum: [ OK ] 2.67 sec. 2026-10-30 09:50:00 01280_unicode_whitespaces_lexer: [ OK ] 0.27 sec. 2026-10-30 09:50:00 02383_join_and_filtering_set: [ SKIPPED ] 0.00 sec. 2026-10-30 09:50:00 Reason: not running for current build 2026-10-30 09:50:00 01545_url_file_format_settings: [ OK ] 0.32 sec. 2026-10-30 09:50:00 02967_parallel_replicas_joins_and_analyzer: [ OK ] 1.27 sec. 2026-10-30 09:50:00 01544_errorCodeToName: [ OK ] 0.32 sec. 2026-10-30 09:50:00 02267_output_format_prometheus: [ OK ] 0.32 sec. 2026-10-30 09:50:00 01284_view_and_extremes_bug: [ OK ] 0.32 sec. 2026-10-30 09:50:00 02735_system_zookeeper_connection: [ OK ] 0.37 sec. 2026-10-30 09:50:01 00625_arrays_in_nested: [ OK ] 0.42 sec. 2026-10-30 09:50:01 00159_whitespace_in_columns_list: [ OK ] 0.37 sec. 2026-10-30 09:50:01 00981_no_virtual_columns: [ OK ] 0.32 sec. 2026-10-30 09:50:01 01943_query_id_check: [ OK ] 0.57 sec. 2026-10-30 09:50:03 00380_client_break_at_exception_in_batch_mode: [ OK ] 2.22 sec. 2026-10-30 09:50:04 02049_lowcardinality_shortcircuit_crash: [ OK ] 0.32 sec. 2026-10-30 09:50:04 02456_aggregate_state_conversion: [ OK ] 0.28 sec. 2026-10-30 09:50:04 02016_summing_mt_aggregating_column: [ OK ] 0.32 sec. 2026-10-30 09:50:05 01560_crash_in_agg_empty_arglist: [ OK ] 0.47 sec. 2026-10-30 09:50:05 00910_crash_when_distributed_modify_order_by: [ OK ] 0.27 sec. 2026-10-30 09:50:06 02845_arrayShiftRotate: [ OK ] 0.43 sec. 2026-10-30 09:50:06 02674_date_int_string_json_inference: [ OK ] 0.27 sec. 2026-10-30 09:50:06 00952_basic_constraints: [ OK ] 5.78 sec. 2026-10-30 09:50:06 03258_old_analyzer_const_expr_bug: [ OK ] 0.32 sec. 2026-10-30 09:50:07 01684_insert_specify_shard_id: [ OK ] 0.42 sec. 2026-10-30 09:50:07 02243_make_date32: [ OK ] 0.47 sec. 2026-10-30 09:50:07 00954_client_prepared_statements: [ OK ] 5.99 sec. 2026-10-30 09:50:07 01651_group_uniq_array_enum: [ OK ] 0.27 sec. 2026-10-30 09:50:07 00129_quantile_timing_weighted: [ OK ] 0.27 sec. 2026-10-30 09:50:07 02181_dictionary_attach_detach: [ OK ] 0.37 sec. 2026-10-30 09:50:08 01763_long_ttl_group_by: [ OK ] 1.02 sec. 2026-10-30 09:50:08 03209_json_type_vertical_merges: [ SKIPPED ] 0.00 sec. 2026-10-30 09:50:08 Reason: not running for current build 2026-10-30 09:50:08 02714_date_date32_in: [ OK ] 0.32 sec. 2026-10-30 09:50:09 00522_multidimensional: [ OK ] 1.27 sec. 2026-10-30 09:50:09 01509_dictionary_preallocate: [ OK ] 2.07 sec. 2026-10-30 09:50:09 Running about 407 stateless tests (Process-3). 2026-10-30 09:50:09 01338_long_select_and_alter: [ OK ] 15.47 sec. 2026-10-30 09:50:10 00370_duplicate_columns_in_subqueries: [ OK ] 0.27 sec. 2026-10-30 09:50:10 01710_projection_drop_if_exists: [ OK ] 0.32 sec. 2026-10-30 09:50:10 00404_null_literal: [ OK ] 0.27 sec. 2026-10-30 09:50:10 03321_functions_to_subcolumns_skip_index: [ OK ] 0.32 sec. 2026-10-30 09:50:10 01655_sleep_infinite_float: [ OK ] 0.27 sec. 2026-10-30 09:50:11 00910_decimal_group_array_crash_3783: [ OK ] 0.42 sec. 2026-10-30 09:50:11 02370_lost_part_intersecting_merges: [ OK ] 14.36 sec. 2026-10-30 09:50:11 01245_limit_infinite_sources: [ OK ] 1.22 sec. 2026-10-30 09:50:11 02267_jsonlines_ndjson_format: [ OK ] 0.32 sec. 2026-10-30 09:50:11 01632_tinylog_read_write: [ OK ] 11.75 sec. 2026-10-30 09:50:11 00831_quantile_weighted_parameter_check: [ OK ] 0.37 sec. 2026-10-30 09:50:11 01072_json_each_row_data_in_square_brackets: [ OK ] 0.32 sec. 2026-10-30 09:50:11 02711_trim_aliases: [ OK ] 0.27 sec. 2026-10-30 09:50:11 00514_interval_operators: [ OK ] 0.47 sec. 2026-10-30 09:50:12 03010_view_prewhere_in: [ OK ] 0.32 sec. 2026-10-30 09:50:12 01655_plan_optimizations: [ OK ] 13.41 sec. 2026-10-30 09:50:12 02989_variant_comparison: [ OK ] 0.52 sec. 2026-10-30 09:50:12 01660_join_or_inner: [ OK ] 0.42 sec. 2026-10-30 09:50:12 02751_protobuf_ipv6: [ OK ] 2.38 sec. 2026-10-30 09:50:12 02481_xxh3_hash_function: [ OK ] 0.27 sec. 2026-10-30 09:50:12 01514_input_format_json_enum_as_number: [ OK ] 0.32 sec. 2026-10-30 09:50:12 00688_aggregation_retention: [ OK ] 0.32 sec. 2026-10-30 09:50:12 01068_parens: [ OK ] 0.27 sec. 2026-10-30 09:50:12 02342_window_view_different_struct: [ OK ] 0.37 sec. 2026-10-30 09:50:12 01906_bigint_accurate_cast_ubsan: [ OK ] 0.47 sec. 2026-10-30 09:50:13 00951_ngram_search: [ OK ] 0.92 sec. 2026-10-30 09:50:13 02220_array_join_format: [ OK ] 0.27 sec. 2026-10-30 09:50:13 03210_empty_tuple_lhs_of_in: [ OK ] 0.27 sec. 2026-10-30 09:50:13 00052_all_left_join: [ OK ] 0.27 sec. 2026-10-30 09:50:13 01548_with_totals_having: [ OK ] 0.32 sec. 2026-10-30 09:50:13 01330_array_join_in_higher_order_function: [ OK ] 0.27 sec. 2026-10-30 09:50:13 03150_grouping_sets_use_nulls_pushdown: [ OK ] 0.43 sec. 2026-10-30 09:50:13 00594_alias_in_distributed: [ OK ] 0.57 sec. 2026-10-30 09:50:13 02455_improve_feedback_when_replacing_partition_with_different_primary_key: [ OK ] 0.37 sec. 2026-10-30 09:50:14 02475_precise_decimal_arithmetics: [ OK ] 0.52 sec. 2026-10-30 09:50:15 03023_zeros_generate_random_with_limit_progress_bar: [ OK ] 1.97 sec. 2026-10-30 09:50:15 01780_column_sparse_full: [ OK ] 0.87 sec. 2026-10-30 09:50:15 00098_shard_i_union_all: [ OK ] 0.37 sec. 2026-10-30 09:50:15 01073_bad_alter_partition: [ OK ] 0.37 sec. 2026-10-30 09:50:16 00734_timeslot: [ OK ] 0.42 sec. 2026-10-30 09:50:16 02454_create_table_with_custom_disk: [ OK ] 0.42 sec. 2026-10-30 09:50:16 01881_create_as_tuple: [ OK ] 0.32 sec. 2026-10-30 09:50:16 02006_use_constants_in_with_and_select: [ OK ] 0.32 sec. 2026-10-30 09:50:16 01710_minmax_count_projection_distributed_query: [ OK ] 0.32 sec. 2026-10-30 09:50:16 00729_prewhere_array_join: [ OK ] 0.47 sec. 2026-10-30 09:50:17 01058_zlib_ng_level1_bug: [ OK ] 4.13 sec. 2026-10-30 09:50:17 01273_arrow_arrays_load: [ OK ] 3.53 sec. 2026-10-30 09:50:17 02999_scalar_subqueries_bug_2: [ OK ] 0.27 sec. 2026-10-30 09:50:17 03039_recursive_cte_postgres_5: [ OK ] 0.42 sec. 2026-10-30 09:50:17 01632_max_partitions_to_read: [ OK ] 0.32 sec. 2026-10-30 09:50:17 02843_backup_use_same_s3_credentials_for_base_backup: [ OK ] 6.04 sec. 2026-10-30 09:50:17 01122_totals_rollup_having_block_header: [ OK ] 0.32 sec. 2026-10-30 09:50:17 01402_cast_nullable_string_to_enum: [ OK ] 0.42 sec. 2026-10-30 09:50:17 03164_linestring_geometry: [ OK ] 0.27 sec. 2026-10-30 09:50:18 01289_min_execution_speed_not_too_early: [ OK ] 0.77 sec. 2026-10-30 09:50:18 01214_point_in_Mecca: [ OK ] 0.87 sec. 2026-10-30 09:50:18 03038_nested_dynamic_merges_compact_horizontal: [ SKIPPED ] 0.00 sec. 2026-10-30 09:50:18 Reason: not running for current build 2026-10-30 09:50:18 00515_shard_desc_table_functions_and_subqueries: [ OK ] 0.32 sec. 2026-10-30 09:50:18 02764_index_analysis_fix: [ OK ] 0.32 sec. 2026-10-30 09:50:18 01946_profile_sleep: [ OK ] 0.97 sec. 2026-10-30 09:50:18 00009_array_join_subquery: [ OK ] 0.27 sec. 2026-10-30 09:50:19 00940_order_by_read_in_order_query_plan: [ OK ] 0.97 sec. 2026-10-30 09:50:19 01518_select_in_null: [ OK ] 1.02 sec. 2026-10-30 09:50:19 01902_table_function_merge_db_params: [ OK ] 0.37 sec. 2026-10-30 09:50:19 02479_mysql_connect_to_self: [ OK ] 0.57 sec. 2026-10-30 09:50:19 01032_duplicate_column_insert_query: [ OK ] 0.37 sec. 2026-10-30 09:50:19 02366_kql_distinct: [ OK ] 0.32 sec. 2026-10-30 09:50:19 01641_memory_tracking_insert_optimize: [ OK ] 0.57 sec. 2026-10-30 09:50:19 03001_bad_error_message_higher_order_functions: [ OK ] 1.98 sec. 2026-10-30 09:50:19 00337_shard_any_heavy: [ OK ] 0.32 sec. 2026-10-30 09:50:19 02868_operator_is_not_distinct_from_priority: [ OK ] 0.32 sec. 2026-10-30 09:50:20 02129_add_column_add_ttl: [ OK ] 0.47 sec. 2026-10-30 09:50:20 01326_build_id: [ OK ] 0.27 sec. 2026-10-30 09:50:20 01710_projections_and_duplicate_columms: [ OK ] 0.37 sec. 2026-10-30 09:50:20 02916_csv_infer_numbers_from_strings: [ OK ] 0.27 sec. 2026-10-30 09:50:20 03093_bug_gcd_codec: [ OK ] 0.37 sec. 2026-10-30 09:50:20 02265_per_table_ttl_mutation_on_change: [ OK ] 0.42 sec. 2026-10-30 09:50:20 00534_functions_bad_arguments11: [ OK ] 7.49 sec. 2026-10-30 09:50:20 01062_pm_multiple_all_join_same_value: [ OK ] 0.32 sec. 2026-10-30 09:50:21 01025_array_compact_generic: [ OK ] 0.32 sec. 2026-10-30 09:50:21 02575_merge_prewhere_default_expression: [ OK ] 0.32 sec. 2026-10-30 09:50:21 03210_optimize_rewrite_aggregate_function_with_if_return_type_bug: [ OK ] 0.37 sec. 2026-10-30 09:50:21 02890_untuple_column_names: [ OK ] 0.37 sec. 2026-10-30 09:50:21 01018_ambiguous_column: [ OK ] 0.37 sec. 2026-10-30 09:50:21 01655_window_functions_bug: [ OK ] 0.32 sec. 2026-10-30 09:50:22 01010_pmj_skip_blocks: [ OK ] 0.77 sec. 2026-10-30 09:50:22 00389_concat_operator: [ OK ] 0.27 sec. 2026-10-30 09:50:22 02699_polygons_sym_difference_total: [ OK ] 0.27 sec. 2026-10-30 09:50:22 03049_unknown_identifier_materialized_column: [ OK ] 0.32 sec. 2026-10-30 09:50:22 02353_ascii: [ OK ] 0.27 sec. 2026-10-30 09:50:22 03041_recursive_cte_postgres_7: [ OK ] 0.52 sec. 2026-10-30 09:50:24 01550_type_map_formats_input: [ OK ] 4.98 sec. 2026-10-30 09:50:25 02539_settings_alias: [ OK ] 4.48 sec. 2026-10-30 09:50:25 03443_projection_sparse: [ OK ] 0.43 sec. 2026-10-30 09:50:26 01825_type_json_7: [ OK ] 3.33 sec. 2026-10-30 09:50:26 02859_replicated_db_name_zookeeper: [ OK ] 3.53 sec. 2026-10-30 09:50:26 03246_json_tuple_decompress_race: [ OK ] 0.47 sec. 2026-10-30 09:50:26 02177_issue_31009: [ OK ] 26.19 sec. 2026-10-30 09:50:27 00917_multiple_joins_denny_crane: [ OK ] 0.32 sec. 2026-10-30 09:50:27 00626_replace_partition_from_table: [ OK ] 0.67 sec. 2026-10-30 09:50:27 02559_multiple_read_steps_in_prewhere_missing_columns_2: [ OK ] 0.32 sec. 2026-10-30 09:50:27 02907_read_buffer_content_is_cached_multiple_blobs: [ OK ] 0.72 sec. 2026-10-30 09:50:28 00077_set_keys_fit_128_bits_many_blocks: [ OK ] 0.27 sec. 2026-10-30 09:50:28 02125_lz4_compression_bug_CSV: [ OK ] 8.45 sec. 2026-10-30 09:50:28 02875_show_functions: [ OK ] 2.67 sec. 2026-10-30 09:50:28 03087_analyzer_subquery_with_alias: [ OK ] 0.27 sec. 2026-10-30 09:50:28 01272_offset_without_limit: [ OK ] 0.32 sec. 2026-10-30 09:50:28 00552_or_nullable: [ OK ] 0.37 sec. 2026-10-30 09:50:28 01043_h3_edge_length_m: [ OK ] 0.27 sec. 2026-10-30 09:50:28 01385_not_function: [ OK ] 0.27 sec. 2026-10-30 09:50:29 02369_analyzer_array_join_function: [ OK ] 0.32 sec. 2026-10-30 09:50:29 00426_nulls_sorting: [ OK ] 0.37 sec. 2026-10-30 09:50:29 00280_hex_escape_sequence: [ OK ] 0.27 sec. 2026-10-30 09:50:29 01611_string_to_low_cardinality_key_alter: [ OK ] 0.47 sec. 2026-10-30 09:50:29 02895_peak_memory_usage_http_headers_regression: [ OK ] 2.12 sec. 2026-10-30 09:50:29 02581_share_big_sets_between_mutation_tasks: [ SKIPPED ] 0.00 sec. 2026-10-30 09:50:29 Reason: not running for current build 2026-10-30 09:50:30 02885_create_distributed_table_without_as: [ OK ] 0.32 sec. 2026-10-30 09:50:30 00338_replicate_array_of_strings: [ OK ] 0.32 sec. 2026-10-30 09:50:30 03204_distributed_with_scalar_subquery: [ OK ] 0.32 sec. 2026-10-30 09:50:31 01176_mysql_client_interactive: [ OK ] 2.42 sec. 2026-10-30 09:50:31 02049_clickhouse_local_merge_tree: [ OK ] 2.18 sec. 2026-10-30 09:50:31 01825_type_json_missed_values: [ OK ] 0.42 sec. 2026-10-30 09:50:31 02962_indexHint_rpn_construction: [ OK ] 0.32 sec. 2026-10-30 09:50:31 02119_sumcount: [ OK ] 0.43 sec. 2026-10-30 09:50:31 02019_multiple_weird_with_fill: [ OK ] 0.27 sec. 2026-10-30 09:50:32 01927_query_views_log_current_database: [ OK ] 0.63 sec. 2026-10-30 09:50:32 02491_part_log_has_table_uuid: [ OK ] 0.37 sec. 2026-10-30 09:50:32 02134_async_inserts_formats: [ OK ] 8.24 sec. 2026-10-30 09:50:32 00004_shard_format_ast_and_remote_table: [ OK ] 0.32 sec. 2026-10-30 09:50:32 03313_case_insensitive_json_type_declaration: [ OK ] 0.27 sec. 2026-10-30 09:50:33 02920_alter_column_of_projections: [ OK ] 1.17 sec. 2026-10-30 09:50:33 00232_format_readable_decimal_size: [ OK ] 0.27 sec. 2026-10-30 09:50:33 01599_multiline_input_and_singleline_comments: [ OK ] 1.32 sec. 2026-10-30 09:50:34 02311_create_table_with_unknown_format: [ OK ] 0.37 sec. 2026-10-30 09:50:34 02508_index_analysis_to_date_timezone: [ OK ] 0.32 sec. 2026-10-30 09:50:34 01521_format_readable_time_delta2: [ OK ] 0.32 sec. 2026-10-30 09:50:34 01825_new_type_json_8: [ OK ] 4.58 sec. 2026-10-30 09:50:34 00825_protobuf_format_nested_in_nested: [ OK ] 3.13 sec. 2026-10-30 09:50:34 01125_generate_random_qoega: [ OK ] 0.52 sec. 2026-10-30 09:50:34 01531_query_log_query_comment: [ OK ] 0.42 sec. 2026-10-30 09:50:34 00732_quorum_insert_lost_part_and_alive_part_zookeeper_long: [ OK ] 0.52 sec. 2026-10-30 09:50:34 03107_ill_formed_select_in_materialized_view: [ OK ] 0.37 sec. 2026-10-30 09:50:35 03205_json_cast_from_string: [ OK ] 0.32 sec. 2026-10-30 09:50:35 02766_bitshift_with_const_arguments: [ OK ] 0.37 sec. 2026-10-30 09:50:35 01505_pipeline_executor_UAF: [ OK ] 13.56 sec. 2026-10-30 09:50:35 01562_agg_null_for_empty_ahead: [ OK ] 0.42 sec. 2026-10-30 09:50:35 01323_add_scalars_in_time: [ OK ] 0.42 sec. 2026-10-30 09:50:36 00964_bloom_index_string_functions: [ OK ] 9.79 sec. 2026-10-30 09:50:36 01710_projection_optimize_materialize: [ OK ] 0.67 sec. 2026-10-30 09:50:36 00937_ipv4_cidr_range: [ OK ] 0.37 sec. 2026-10-30 09:50:36 02669_alter_modify_to_nullable: [ OK ] 0.57 sec. 2026-10-30 09:50:36 00649_quantile_tdigest_negative: [ OK ] 0.32 sec. 2026-10-30 09:50:36 00033_fixed_string_to_string: [ OK ] 0.27 sec. 2026-10-30 09:50:36 00008_array_join: [ OK ] 0.27 sec. 2026-10-30 09:50:36 02982_create_mv_inner_extra: [ OK ] 0.37 sec. 2026-10-30 09:50:36 01851_array_difference_decimal_overflow_ubsan: [ OK ] 0.32 sec. 2026-10-30 09:50:36 00580_cast_nullable_to_non_nullable: [ OK ] 0.27 sec. 2026-10-30 09:50:36 01497_alias_on_default_array: [ OK ] 0.32 sec. 2026-10-30 09:50:36 02287_ephemeral_format_crash: [ OK ] 0.32 sec. 2026-10-30 09:50:37 02355_column_type_name_lc: [ OK ] 0.27 sec. 2026-10-30 09:50:37 02480_suspicious_lowcard_in_key: [ OK ] 0.37 sec. 2026-10-30 09:50:37 00502_sum_map: [ OK ] 0.52 sec. 2026-10-30 09:50:37 03015_with_fill_invalid_expression: [ OK ] 0.32 sec. 2026-10-30 09:50:37 02513_prewhere_combine_step_filters: [ OK ] 0.42 sec. 2026-10-30 09:50:37 02833_tuple_concat: [ OK ] 0.42 sec. 2026-10-30 09:50:38 00441_nulls_in: [ OK ] 0.37 sec. 2026-10-30 09:50:38 02225_hints_for_indeices: [ OK ] 3.38 sec. 2026-10-30 09:50:38 01182_materialized_view_different_structure: [ OK ] 0.62 sec. 2026-10-30 09:50:38 00477_parsing_data_types: [ OK ] 0.27 sec. 2026-10-30 09:50:38 02896_optimize_array_exists_to_has_with_date: [ OK ] 0.27 sec. 2026-10-30 09:50:38 00434_tonullable: [ OK ] 0.27 sec. 2026-10-30 09:50:38 03023_invalid_format_detection: [ OK ] 2.08 sec. 2026-10-30 09:50:39 01853_s2_cells_intersect: [ OK ] 0.37 sec. 2026-10-30 09:50:39 00639_startsWith: [ OK ] 0.37 sec. 2026-10-30 09:50:39 01083_aggregation_memory_efficient_bug: [ OK ] 0.52 sec. 2026-10-30 09:50:39 01047_simple_aggregate_sizes_of_columns_bug: [ OK ] 1.37 sec. 2026-10-30 09:50:39 00936_function_result_with_operator_in: [ OK ] 0.42 sec. 2026-10-30 09:50:39 01778_where_with_column_name: [ OK ] 0.32 sec. 2026-10-30 09:50:39 02908_filesystem_cache_as_collection: [ OK ] 0.28 sec. 2026-10-30 09:50:40 03217_primary_index_memory_leak: [ OK ] 3.18 sec. 2026-10-30 09:50:40 02245_s3_schema_desc: [ OK ] 0.37 sec. 2026-10-30 09:50:40 02674_trivial_count_analyzer: [ OK ] 0.62 sec. 2026-10-30 09:50:40 03126_column_not_under_group_by: [ OK ] 0.32 sec. 2026-10-30 09:50:41 02100_multiple_hosts_command_line_set_ssl: [ OK ] 33.10 sec. 2026-10-30 09:50:41 02884_string_distance_function: [ OK ] 0.62 sec. 2026-10-30 09:50:41 02255_broken_parts_chain_on_start: [ OK ] 6.74 sec. 2026-10-30 09:50:41 02161_addressToLineWithInlines: [ SKIPPED ] 0.00 sec. 2026-10-30 09:50:41 Reason: not running for current build 2026-10-30 09:50:41 02384_analyzer_dict_get_join_get: [ OK ] 0.47 sec. 2026-10-30 09:50:41 02176_toStartOfWeek_overflow_pruning: [ OK ] 0.37 sec. 2026-10-30 09:50:41 01000_unneeded_substitutions_client: [ OK ] 2.18 sec. 2026-10-30 09:50:41 00880_decimal_in_key: [ OK ] 1.52 sec. 2026-10-30 09:50:41 01914_index_bgranvea: [ OK ] 0.32 sec. 2026-10-30 09:50:42 01125_dict_ddl_cannot_add_column: [ OK ] 0.32 sec. 2026-10-30 09:50:42 02513_broken_datetime64_init_on_mac: [ OK ] 0.27 sec. 2026-10-30 09:50:42 00307_format_xml: [ OK ] 0.27 sec. 2026-10-30 09:50:42 02458_datediff_date32: [ OK ] 0.57 sec. 2026-10-30 09:50:42 00800_low_cardinality_empty_array: [ OK ] 0.32 sec. 2026-10-30 09:50:43 01493_table_function_null: [ OK ] 0.27 sec. 2026-10-30 09:50:43 02324_map_combinator_bug: [ OK ] 0.37 sec. 2026-10-30 09:50:43 00837_minmax_index: [ OK ] 3.83 sec. 2026-10-30 09:50:43 02697_stop_reading_on_first_cancel: [ OK ] 3.18 sec. 2026-10-30 09:50:43 00393_if_with_constant_condition: [ OK ] 0.32 sec. 2026-10-30 09:50:43 02206_clickhouse_local_use_database: [ OK ] 2.13 sec. 2026-10-30 09:50:43 01277_large_tuples: [ OK ] 0.32 sec. 2026-10-30 09:50:43 03113_analyzer_not_found_column_in_block_2: [ OK ] 0.37 sec. 2026-10-30 09:50:43 00916_add_materialized_column_after: [ OK ] 0.27 sec. 2026-10-30 09:50:43 02353_isnullable: [ OK ] 0.32 sec. 2026-10-30 09:50:43 00231_format_vertical_raw: [ OK ] 0.27 sec. 2026-10-30 09:50:43 00339_parsing_bad_arrays: [ OK ] 1.92 sec. 2026-10-30 09:50:44 02785_left_anti_join_bug: [ OK ] 0.37 sec. 2026-10-30 09:50:44 04033_except_transformer_with_alias: [ OK ] 0.37 sec. 2026-10-30 09:50:44 00355_array_of_non_const_convertible_types: [ OK ] 0.27 sec. 2026-10-30 09:50:44 01595_countMatches: [ OK ] 0.42 sec. 2026-10-30 09:50:44 03150_dynamic_type_mv_insert: [ OK ] 0.42 sec. 2026-10-30 09:50:44 01032_cityHash64_for_UUID: [ OK ] 0.32 sec. 2026-10-30 09:50:44 00252_shard_global_in_aggregate_function: [ OK ] 0.32 sec. 2026-10-30 09:50:44 01189_create_as_table_as_table_function: [ OK ] 0.32 sec. 2026-10-30 09:50:44 01787_arena_assert_column_nothing: [ OK ] 0.32 sec. 2026-10-30 09:50:44 02012_changed_enum_type_non_replicated: [ OK ] 0.32 sec. 2026-10-30 09:50:44 02565_update_empty_nested: [ OK ] 0.42 sec. 2026-10-30 09:50:45 03080_analyzer_prefer_column_name_to_alias__virtual_columns: [ OK ] 0.32 sec. 2026-10-30 09:50:45 01961_roaring_memory_tracking: [ SKIPPED ] 0.00 sec. 2026-10-30 09:50:45 Reason: not running for current build 2026-10-30 09:50:45 01538_fuzz_aggregate: [ OK ] 0.32 sec. 2026-10-30 09:50:45 01246_extractAllGroupsVertical: [ OK ] 0.52 sec. 2026-10-30 09:50:45 03022_alter_materialized_view_query_has_inner_table: [ OK ] 0.32 sec. 2026-10-30 09:50:46 02461_mullable_pk_monotonicity_bug: [ OK ] 0.57 sec. 2026-10-30 09:50:46 03200_memory_engine_alter_dynamic: [ OK ] 0.32 sec. 2026-10-30 09:50:46 02274_full_sort_join_nodistinct: [ OK ] 2.78 sec. 2026-10-30 09:50:46 02921_bit_hamming_distance_big_int: [ OK ] 0.32 sec. 2026-10-30 09:50:47 01665_substring_ubsan: [ OK ] 0.27 sec. 2026-10-30 09:50:48 02842_one_input_format: [ OK ] 4.18 sec. 2026-10-30 09:50:48 02915_input_table_function_in_subquery: [ OK ] 2.38 sec. 2026-10-30 09:50:49 02899_distributed_limit_by: [ OK ] 0.67 sec. 2026-10-30 09:50:49 02043_query_obfuscator_embedded_dictionaries: [ OK ] 1.93 sec. 2026-10-30 09:50:49 00411_long_accurate_number_comparison_int4: [ OK ] 4.08 sec. 2026-10-30 09:50:49 01772_to_start_of_hour_align: [ OK ] 0.37 sec. 2026-10-30 09:50:49 03215_varian_as_common_type_integers: [ OK ] 0.32 sec. 2026-10-30 09:50:49 01871_merge_tree_compile_expressions: [ OK ] 0.57 sec. 2026-10-30 09:50:49 01251_string_comparison: [ OK ] 0.27 sec. 2026-10-30 09:50:49 03003_analyzer_setting: [ OK ] 0.32 sec. 2026-10-30 09:50:50 02916_set_formatting: [ OK ] 0.27 sec. 2026-10-30 09:50:50 01353_neighbor_overflow: [ OK ] 0.37 sec. 2026-10-30 09:50:51 03207_json_read_subcolumns_1_compact_merge_tree: [ OK ] 2.13 sec. 2026-10-30 09:50:51 01949_heredoc_unfinished: [ OK ] 1.77 sec. 2026-10-30 09:50:51 00534_functions_bad_arguments7: [ OK ] 6.49 sec. 2026-10-30 09:50:51 03008_uniq_exact_equal_ranges: [ OK ] 2.07 sec. 2026-10-30 09:50:52 03079_analyzer_numeric_literals_as_column_names: [ OK ] 0.32 sec. 2026-10-30 09:50:52 02428_delete_with_settings: [ OK ] 0.62 sec. 2026-10-30 09:50:52 00351_select_distinct_arrays_tuples: [ OK ] 0.32 sec. 2026-10-30 09:50:52 01421_array_nullable_element_nullable_index: [ OK ] 0.27 sec. 2026-10-30 09:50:53 00800_low_cardinality_merge_join: [ OK ] 0.77 sec. 2026-10-30 09:50:56 02783_parallel_replicas_trivial_count_optimization: [ OK ] 4.28 sec. 2026-10-30 09:50:56 01666_merge_tree_max_query_limit: [ OK ] 5.89 sec. 2026-10-30 09:50:57 00955_complex_prepared_statements: [ OK ] 4.43 sec. 2026-10-30 09:50:57 01910_view_dictionary_check_refresh: [ OK ] 24.43 sec. 2026-10-30 09:50:57 02881_system_detached_parts_modification_time: [ OK ] 0.32 sec. 2026-10-30 09:50:57 02708_dotProduct: [ OK ] 0.57 sec. 2026-10-30 09:50:57 02809_has_token: [ OK ] 0.27 sec. 2026-10-30 09:50:57 02183_combinator_if: [ OK ] 0.52 sec. 2026-10-30 09:50:57 03036_dynamic_read_shared_subcolumns_compact_merge_tree: [ SKIPPED ] 0.00 sec. 2026-10-30 09:50:57 Reason: not running for current build 2026-10-30 09:50:57 00606_quantiles_and_nans: [ OK ] 0.32 sec. 2026-10-30 09:50:57 01055_compact_parts_1: [ OK ] 0.37 sec. 2026-10-30 09:50:58 01352_generate_random_overflow: [ OK ] 0.27 sec. 2026-10-30 09:50:58 01062_pm_all_join_with_block_continuation: [ OK ] 16.92 sec. 2026-10-30 09:50:58 01034_JSONCompactEachRow: [ OK ] 0.52 sec. 2026-10-30 09:50:58 01070_alter_with_ttl: [ OK ] 0.32 sec. 2026-10-30 09:50:58 02555_davengers_rename_chain: [ OK ] 5.43 sec. 2026-10-30 09:50:58 03152_trailing_comma_in_columns_list_in_insert: [ OK ] 0.32 sec. 2026-10-30 09:50:58 01940_custom_tld_sharding_key: [ OK ] 0.32 sec. 2026-10-30 09:50:58 03037_dynamic_merges_2_vertical_compact_merge_tree: [ SKIPPED ] 0.00 sec. 2026-10-30 09:50:58 Reason: not running for current build 2026-10-30 09:50:58 01634_sum_map_nulls: [ OK ] 0.32 sec. 2026-10-30 09:50:59 00743_limit_by_not_found_column: [ OK ] 0.32 sec. 2026-10-30 09:50:59 01049_join_low_card_bug_long: [ OK ] 3.03 sec. 2026-10-30 09:50:59 03154_recursive_cte_distributed: [ OK ] 0.47 sec. 2026-10-30 09:50:59 02910_object-json-crash-add-column: [ OK ] 0.42 sec. 2026-10-30 09:50:59 02864_filtered_url_with_globs: [ OK ] 0.32 sec. 2026-10-30 09:50:59 03043_group_array_result_is_expected: [ OK ] 0.32 sec. 2026-10-30 09:51:00 00969_roundDuration: [ OK ] 0.32 sec. 2026-10-30 09:51:00 00341_squashing_insert_select2: [ OK ] 0.42 sec. 2026-10-30 09:51:00 01702_toDateTime_from_string_clamping: [ OK ] 0.32 sec. 2026-10-30 09:51:01 02833_url_without_path_encoding: [ OK ] 2.33 sec. 2026-10-30 09:51:01 03013_forbid_attach_table_if_active_replica_already_exists: [ OK ] 3.13 sec. 2026-10-30 09:51:02 02295_GROUP_BY_AggregateFunction: [ OK ] 0.32 sec. 2026-10-30 09:51:02 02053_INSERT_SELECT_MATERIALIZED: [ OK ] 0.32 sec. 2026-10-30 09:51:02 02661_read_from_archive_zip: [ OK ] 11.65 sec. 2026-10-30 09:51:02 01825_type_json_in_other_types: [ OK ] 4.48 sec. 2026-10-30 09:51:02 00535_parse_float_scientific: [ OK ] 0.32 sec. 2026-10-30 09:51:02 01034_unknown_qualified_column_in_join: [ OK ] 0.32 sec. 2026-10-30 09:51:02 02688_aggregate_states: [ OK ] 0.47 sec. 2026-10-30 09:51:02 00275_shard_quantiles_weighted: [ OK ] 0.47 sec. 2026-10-30 09:51:02 00847_multiple_join_same_column: [ OK ] 0.37 sec. 2026-10-30 09:51:03 03020_long_values_pretty_are_not_cut_if_single: [ OK ] 3.63 sec. 2026-10-30 09:51:03 02490_replacing_merge_tree_is_deleted_column_transform_opt: [ OK ] 0.57 sec. 2026-10-30 09:51:03 02421_truncate_isolation_with_mutations: [ OK ] 19.12 sec. 2026-10-30 09:51:03 02456_alter-nullable-column-bag-2: [ OK ] 0.37 sec. 2026-10-30 09:51:03 03015_optimize_final_rmt: [ SKIPPED ] 0.00 sec. 2026-10-30 09:51:03 Reason: not running for current build 2026-10-30 09:51:03 00687_insert_into_mv: [ OK ] 0.37 sec. 2026-10-30 09:51:03 00320_between: [ OK ] 0.32 sec. 2026-10-30 09:51:03 00650_array_enumerate_uniq_with_tuples: [ OK ] 0.37 sec. 2026-10-30 09:51:03 01213_alter_rename_nested: [ OK ] 0.42 sec. 2026-10-30 09:51:03 01322_cast_keep_nullable: [ OK ] 0.32 sec. 2026-10-30 09:51:03 03095_msan_uuid_string_to_num: [ OK ] 0.32 sec. 2026-10-30 09:51:04 00829_bitmap_function: [ OK ] 0.82 sec. 2026-10-30 09:51:04 00267_tuple_array_access_operators_priority: [ OK ] 0.27 sec. 2026-10-30 09:51:04 02024_compile_expressions_with_short_circuit_evaluation: [ OK ] 0.32 sec. 2026-10-30 09:51:04 02932_parallel_replicas_fuzzer: [ OK ] 0.32 sec. 2026-10-30 09:51:04 03161_cnf_reduction: [ OK ] 0.42 sec. 2026-10-30 09:51:04 02122_parallel_formatting_CustomSeparated: [ OK ] 3.73 sec. 2026-10-30 09:51:04 01440_big_int_exotic_casts: [ OK ] 0.47 sec. 2026-10-30 09:51:04 02023_storage_filelog: [ OK ] 6.03 sec. 2026-10-30 09:51:04 02806_cte_block_cannot_be_empty: [ OK ] 0.27 sec. 2026-10-30 09:51:04 03160_dynamic_type_agg: [ OK ] 0.27 sec. 2026-10-30 09:51:05 02554_format_json_columns_for_empty: [ OK ] 0.32 sec. 2026-10-30 09:51:05 00550_join_insert_select: [ OK ] 2.38 sec. 2026-10-30 09:51:05 01100_split_by_string: [ OK ] 0.32 sec. 2026-10-30 09:51:05 01663_test_toDate_mysql_compatibility: [ OK ] 0.27 sec. 2026-10-30 09:51:05 02797_range_nullable: [ OK ] 0.47 sec. 2026-10-30 09:51:05 02374_analyzer_join_using: [ OK ] 1.08 sec. 2026-10-30 09:51:06 03151_dynamic_type_scale_max_types: [ OK ] 0.42 sec. 2026-10-30 09:51:06 00394_new_nested_column_keeps_offsets: [ OK ] 0.37 sec. 2026-10-30 09:51:06 00151_tuple_with_array: [ OK ] 0.32 sec. 2026-10-30 09:51:06 00688_low_cardinality_dictionary_deserialization: [ OK ] 1.57 sec. 2026-10-30 09:51:06 00832_storage_file_lock: [ OK ] 0.37 sec. 2026-10-30 09:51:07 02412_nlp: [ OK ] 0.27 sec. 2026-10-30 09:51:07 00429_point_in_ellipses: [ OK ] 0.27 sec. 2026-10-30 09:51:07 02122_parallel_formatting_RowBinaryWithNames: [ OK ] 3.28 sec. 2026-10-30 09:51:07 02692_multiple_joins_unicode: [ OK ] 0.37 sec. 2026-10-30 09:51:07 00623_replicated_truncate_table_zookeeper_long: [ OK ] 0.52 sec. 2026-10-30 09:51:07 02923_cte_equality_disjunction: [ OK ] 0.32 sec. 2026-10-30 09:51:07 02151_client_option_echo: [ OK ] 2.78 sec. 2026-10-30 09:51:07 02807_lower_utf8_msan: [ OK ] 0.32 sec. 2026-10-30 09:51:07 01507_transform_null_in: [ OK ] 0.32 sec. 2026-10-30 09:51:07 02456_alter-nullable-column-bag: [ OK ] 0.37 sec. 2026-10-30 09:51:08 02525_different_engines_in_temporary_tables: [ OK ] 0.42 sec. 2026-10-30 09:51:08 01043_dictionary_attribute_properties_values: [ OK ] 0.32 sec. 2026-10-30 09:51:08 01917_system_data_skipping_indices: [ OK ] 0.37 sec. 2026-10-30 09:51:08 01477_lc_in_merge_join_left_key: [ OK ] 0.67 sec. 2026-10-30 09:51:09 03273_dictionary_rbac: [ OK ] 3.58 sec. 2026-10-30 09:51:09 02813_seriesDecomposeSTL: [ OK ] 0.42 sec. 2026-10-30 09:51:09 01825_new_type_json_distributed: [ OK ] 0.37 sec. 2026-10-30 09:51:09 02933_group_by_memory_usage: [ OK ] 3.53 sec. 2026-10-30 09:51:09 03033_analyzer_resolve_from_parent_scope: [ OK ] 0.42 sec. 2026-10-30 09:51:09 01527_materialized_view_stack_overflow: [ OK ] 0.87 sec. 2026-10-30 09:51:10 03008_index_small: [ OK ] 0.32 sec. 2026-10-30 09:51:10 03199_join_with_materialized_column: [ OK ] 0.32 sec. 2026-10-30 09:51:10 01925_date_date_time_comparison: [ OK ] 0.27 sec. 2026-10-30 09:51:10 00647_select_numbers_with_offset: [ OK ] 0.27 sec. 2026-10-30 09:51:10 01413_if_array_uuid: [ OK ] 0.27 sec. 2026-10-30 09:51:10 02311_range_hashed_dictionary_range_cast: [ OK ] 0.32 sec. 2026-10-30 09:51:11 03261_sort_cursor_crash: [ OK ] 0.37 sec. 2026-10-30 09:51:11 03143_cte_scope: [ OK ] 0.37 sec. 2026-10-30 09:51:11 02421_new_type_json_async_insert: [ OK ] 3.98 sec. 2026-10-30 09:51:11 00725_memory_tracking: [ OK ] 0.92 sec. 2026-10-30 09:51:12 02552_analyzer_optimize_group_by_function_keys_crash: [ OK ] 0.27 sec. 2026-10-30 09:51:12 02789_functions_after_sorting_and_columns_with_same_names_bug: [ OK ] 0.32 sec. 2026-10-30 09:51:12 02680_default_star: [ OK ] 0.27 sec. 2026-10-30 09:51:13 02493_numeric_literals_with_underscores: [ OK ] 0.67 sec. 2026-10-30 09:51:13 00953_constraints_operations: [ OK ] 4.88 sec. 2026-10-30 09:51:13 01056_prepared_statements_null_and_escaping: [ OK ] 1.92 sec. 2026-10-30 09:51:13 01014_format_custom_separated: [ OK ] 4.04 sec. 2026-10-30 09:51:14 02104_clickhouse_local_columns_description: [ OK ] 2.02 sec. 2026-10-30 09:51:14 00999_test_skip_indices_with_alter_and_merge: [ OK ] 0.32 sec. 2026-10-30 09:51:14 01550_create_map_type: [ OK ] 0.92 sec. 2026-10-30 09:51:14 00448_to_string_cut_to_zero: [ OK ] 0.27 sec. 2026-10-30 09:51:14 02385_analyzer_aliases_compound_expression: [ OK ] 0.37 sec. 2026-10-30 09:51:14 02792_alter_table_modify_comment: [ OK ] 1.72 sec. 2026-10-30 09:51:14 00472_create_view_if_not_exists: [ OK ] 0.27 sec. 2026-10-30 09:51:15 03205_json_syntax: [ OK ] 0.37 sec. 2026-10-30 09:51:15 01891_partition_by_uuid: [ OK ] 0.32 sec. 2026-10-30 09:51:15 03155_explain_current_transaction: [ OK ] 0.27 sec. 2026-10-30 09:51:15 02280_add_query_level_settings: [ OK ] 0.37 sec. 2026-10-30 09:51:16 03208_numbers_total_rows_approx: [ OK ] 0.27 sec. 2026-10-30 09:51:16 00926_adaptive_index_granularity_merge_tree: [ OK ] 1.12 sec. 2026-10-30 09:51:16 01921_with_fill_with_totals: [ OK ] 0.32 sec. 2026-10-30 09:51:16 00732_decimal_summing_merge_tree: [ OK ] 0.37 sec. 2026-10-30 09:51:16 01504_rocksdb: [ OK ] 2.12 sec. 2026-10-30 09:51:17 01710_projection_with_ast_rewrite_settings: [ OK ] 0.37 sec. 2026-10-30 09:51:17 00709_virtual_column_partition_id: [ OK ] 0.32 sec. 2026-10-30 09:51:17 02963_remote_read_small_buffer_size_bug: [ OK ] 8.55 sec. 2026-10-30 09:51:17 01013_hex_decimal: [ OK ] 0.32 sec. 2026-10-30 09:51:17 02891_rename_table_without_keyword: [ OK ] 0.42 sec. 2026-10-30 09:51:17 00980_crash_nullable_decimal: [ OK ] 0.32 sec. 2026-10-30 09:51:17 02990_optimize_uniq_to_count_alias: [ OK ] 0.32 sec. 2026-10-30 09:51:17 00538_datediff: [ OK ] 0.42 sec. 2026-10-30 09:51:17 00239_type_conversion_in_in: [ OK ] 0.32 sec. 2026-10-30 09:51:17 02267_insert_empty_data: [ OK ] 0.27 sec. 2026-10-30 09:51:18 03008_deduplication_wrong_mv: [ OK ] 0.27 sec. 2026-10-30 09:51:18 01355_alter_column_with_order: [ OK ] 0.37 sec. 2026-10-30 09:51:18 00609_distributed_with_case_when_then: [ OK ] 0.32 sec. 2026-10-30 09:51:18 00263_merge_aggregates_and_overflow: [ OK ] 0.32 sec. 2026-10-30 09:51:18 00331_final_and_prewhere: [ OK ] 0.33 sec. 2026-10-30 09:51:18 01293_show_settings: [ OK ] 0.32 sec. 2026-10-30 09:51:18 02174_cte_scalar_cache_mv: [ OK ] 1.27 sec. 2026-10-30 09:51:18 02286_convert_decimal_type: [ OK ] 0.27 sec. 2026-10-30 09:51:19 01835_alias_to_primary_key_cyfdecyf: [ OK ] 0.32 sec. 2026-10-30 09:51:19 02002_row_level_filter_bug: [ OK ] 5.98 sec. 2026-10-30 09:51:19 01700_point_in_polygon_ubsan: [ OK ] 0.32 sec. 2026-10-30 09:51:19 02987_group_array_intersect: [ OK ] 1.12 sec. 2026-10-30 09:51:20 03098_prefer_column_to_alias_subquery: [ OK ] 0.42 sec. 2026-10-30 09:51:20 03040_dynamic_type_alters_1_wide_merge_tree: [ OK ] 0.67 sec. 2026-10-30 09:51:20 03064_analyzer_named_subqueries: [ OK ] 0.27 sec. 2026-10-30 09:51:20 01019_materialized_view_select_extra_columns: [ OK ] 0.32 sec. 2026-10-30 09:51:20 01788_update_nested_type_subcolumn_check: [ OK ] 0.62 sec. 2026-10-30 09:51:21 02731_nothing_deserialization: [ OK ] 0.37 sec. 2026-10-30 09:51:21 01413_alter_update_supertype: [ OK ] 0.32 sec. 2026-10-30 09:51:21 02319_dict_get_check_arguments_size: [ OK ] 0.47 sec. 2026-10-30 09:51:21 00674_join_on_syntax: [ OK ] 0.67 sec. 2026-10-30 09:51:22 02346_into_outfile_and_stdout: [ OK ] 3.63 sec. 2026-10-30 09:51:22 00688_low_cardinality_in: [ OK ] 0.37 sec. 2026-10-30 09:51:23 00974_adaptive_granularity_secondary_index: [ OK ] 0.47 sec. 2026-10-30 09:51:23 00296_url_parameters: [ OK ] 0.32 sec. 2026-10-30 09:51:23 02732_rename_after_processing: [ OK ] 4.43 sec. 2026-10-30 09:51:23 02840_merge__table_or_filter: [ OK ] 0.47 sec. 2026-10-30 09:51:24 00909_arrayEnumerateUniq: [ OK ] 1.17 sec. 2026-10-30 09:51:25 01091_insert_with_default_json: [ OK ] 0.32 sec. 2026-10-30 09:51:25 01358_lc_parquet: [ OK ] 6.54 sec. 2026-10-30 09:51:25 01755_shard_pruning_with_literal: [ OK ] 0.27 sec. 2026-10-30 09:51:26 02592_avro_records_with_same_names: [ OK ] 2.17 sec. 2026-10-30 09:51:26 01049_window_view_window_functions: [ OK ] 0.57 sec. 2026-10-30 09:51:26 02113_base64encode_trailing_bytes_1: [ OK ] 0.27 sec. 2026-10-30 09:51:26 03250_SYSTEM_DROP_FORMAT_SCHEMA_CACHE_FOR_Protobuf: [ OK ] 22.28 sec. 2026-10-30 09:51:26 02024_compression_in_query: [ OK ] 4.83 sec. 2026-10-30 09:51:26 00697_in_subquery_shard: [ OK ] 0.52 sec. 2026-10-30 09:51:26 00916_join_using_duplicate_columns: [ OK ] 0.42 sec. 2026-10-30 09:51:27 02734_big_int_from_float_ubsan: [ OK ] 0.27 sec. 2026-10-30 09:51:27 02724_mutliple_storage_join: [ OK ] 0.32 sec. 2026-10-30 09:51:27 02918_template_format_deadlock: [ OK ] 2.07 sec. 2026-10-30 09:51:27 00974_fix_join_on: [ OK ] 0.52 sec. 2026-10-30 09:51:27 01710_normal_projection_format: [ OK ] 0.32 sec. 2026-10-30 09:51:27 02188_table_function_format: [ OK ] 0.32 sec. 2026-10-30 09:51:27 01892_setting_limit_offset_distributed: [ OK ] 0.37 sec. 2026-10-30 09:51:27 00183_skip_unavailable_shards: [ OK ] 24.30 sec. 2026-10-30 09:51:27 01303_polygons_equals: [ OK ] 0.32 sec. 2026-10-30 09:51:27 03014_window_view_crash: [ OK ] 0.27 sec. 2026-10-30 09:51:27 01821_to_date_time_ubsan: [ OK ] 0.32 sec. 2026-10-30 09:51:27 03003_compatibility_setting_bad_value: [ OK ] 0.27 sec. 2026-10-30 09:51:27 03040_array_sum_and_join: [ OK ] 0.27 sec. 2026-10-30 09:51:28 02096_date_time_1970_saturation: [ OK ] 0.37 sec. 2026-10-30 09:51:28 03095_merge_and_buffer_tables: [ OK ] 0.42 sec. 2026-10-30 09:51:28 02223_h3_test_const_columns: [ OK ] 0.47 sec. 2026-10-30 09:51:28 01011_group_uniq_array_memsan: [ OK ] 0.27 sec. 2026-10-30 09:51:28 02354_vector_search_legacy_index_compatibility: [ OK ] 0.37 sec. 2026-10-30 09:51:28 00483_reading_from_array_structure: [ OK ] 0.32 sec. 2026-10-30 09:51:29 00753_alter_destination_for_storage_buffer: [ OK ] 0.42 sec. 2026-10-30 09:51:29 02001_append_output_file: [ OK ] 2.28 sec. 2026-10-30 09:51:29 02974_analyzer_array_join_subcolumn: [ OK ] 0.37 sec. 2026-10-30 09:51:30 00900_null_array_orc_load: [ OK ] 3.03 sec. 2026-10-30 09:51:31 03143_group_by_constant_secondary: [ OK ] 0.32 sec. 2026-10-30 09:51:31 01518_cast_nullable_virtual_system_column: [ OK ] 0.32 sec. 2026-10-30 09:51:31 03167_base64_url_functions: [ OK ] 0.32 sec. 2026-10-30 09:51:32 01715_background_checker_blather_zookeeper_long: [ OK ] 10.45 sec. 2026-10-30 09:51:32 02392_every_setting_must_have_documentation: [ OK ] 0.32 sec. 2026-10-30 09:51:32 02999_ulid_short_circuit: [ OK ] 0.32 sec. 2026-10-30 09:51:33 00439_fixed_string_filter: [ OK ] 0.27 sec. 2026-10-30 09:51:33 02122_parallel_formatting_JSONCompactStringsEachRowWithNames: [ OK ] 3.43 sec. 2026-10-30 09:51:33 02354_vector_search_default_granularity: [ OK ] 0.32 sec. 2026-10-30 09:51:33 02039_group_by_with_totals_having: [ OK ] 0.27 sec. 2026-10-30 09:51:33 03290_limit_by_segv: [ OK ] 0.32 sec. 2026-10-30 09:51:34 02025_storage_filelog_virtual_col: [ OK ] 6.28 sec. 2026-10-30 09:51:34 00632_aggregation_window_funnel: [ OK ] 0.82 sec. 2026-10-30 09:51:34 00800_low_cardinality_distributed_insert: [ OK ] 0.32 sec. 2026-10-30 09:51:35 02475_analysis_of_variance: [ OK ] 0.42 sec. 2026-10-30 09:51:35 02535_ip_parser_not_whole: [ OK ] 0.32 sec. 2026-10-30 09:51:35 02141_clickhouse_local_interactive_table: [ OK ] 2.28 sec. 2026-10-30 09:51:36 02900_clickhouse_local_drop_current_database: [ OK ] 2.03 sec. 2026-10-30 09:51:36 01381_for_each_with_states: [ OK ] 0.32 sec. 2026-10-30 09:51:37 00362_great_circle_distance: [ OK ] 0.32 sec. 2026-10-30 09:51:37 02263_format_insert_settings: [ OK ] 7.59 sec. 2026-10-30 09:51:37 00229_prewhere_column_missing: [ OK ] 0.37 sec. 2026-10-30 09:51:37 01069_materialized_view_alter_target_table: [ OK ] 0.32 sec. 2026-10-30 09:51:37 00570_empty_array_is_const: [ OK ] 0.27 sec. 2026-10-30 09:51:38 01518_filtering_aliased_materialized_column: [ OK ] 0.32 sec. 2026-10-30 09:51:38 02982_comments_in_system_tables: [ OK ] 2.38 sec. 2026-10-30 09:51:38 02013_emptystring_cast: [ OK ] 0.32 sec. 2026-10-30 09:51:38 00678_shard_funnel_window: [ OK ] 0.57 sec. 2026-10-30 09:51:38 02382_join_and_filtering_set: [ OK ] 0.37 sec. 2026-10-30 09:51:38 01473_system_events_zeroes: [ OK ] 0.27 sec. 2026-10-30 09:51:38 02842_vertical_merge_after_add_drop_column: [ OK ] 0.32 sec. 2026-10-30 09:51:38 03036_parquet_arrow_nullable: [ OK ] 12.15 sec. 2026-10-30 09:51:38 02381_parseDateTime64BestEffortUS: [ OK ] 0.27 sec. 2026-10-30 09:51:39 02735_array_map_array_of_tuples: [ OK ] 0.32 sec. 2026-10-30 09:51:39 00944_ml_test: [ OK ] 0.32 sec. 2026-10-30 09:51:39 01802_rank_corr_mann_whitney_over_window: [ OK ] 0.37 sec. 2026-10-30 09:51:39 01292_quantile_array_bug: [ OK ] 0.27 sec. 2026-10-30 09:51:39 01937_nested_chinese: [ OK ] 0.27 sec. 2026-10-30 09:51:39 01123_parse_date_time_best_effort_even_more: [ OK ] 0.27 sec. 2026-10-30 09:51:39 02355_control_block_size_in_array_join: [ OK ] 0.42 sec. 2026-10-30 09:51:39 01825_new_type_json_12: [ OK ] 4.23 sec. 2026-10-30 09:51:40 01523_interval_operator_support_string_literal: [ OK ] 0.37 sec. 2026-10-30 09:51:40 01076_predicate_optimizer_with_view: [ OK ] 0.32 sec. 2026-10-30 09:51:40 00842_array_with_constant_overflow: [ OK ] 0.32 sec. 2026-10-30 09:51:40 02027_ngrams: [ OK ] 0.42 sec. 2026-10-30 09:51:40 02132_client_history_navigation: [ OK ] 2.13 sec. 2026-10-30 09:51:40 02008_materialize_column: [ OK ] 0.47 sec. 2026-10-30 09:51:40 02364_window_case: [ OK ] 0.27 sec. 2026-10-30 09:51:41 00876_wrong_arraj_join_column: [ OK ] 0.27 sec. 2026-10-30 09:51:41 01457_order_by_nulls_first: [ OK ] 0.42 sec. 2026-10-30 09:51:41 02886_binary_like: [ OK ] 0.37 sec. 2026-10-30 09:51:41 01106_const_fixed_string_like: [ OK ] 0.42 sec. 2026-10-30 09:51:41 01451_detach_drop_part: [ OK ] 0.42 sec. 2026-10-30 09:51:41 01746_forbid_drop_column_referenced_by_mv: [ OK ] 0.62 sec. 2026-10-30 09:51:41 01680_predicate_pushdown_union_distinct_subquery: [ OK ] 0.27 sec. 2026-10-30 09:51:42 01419_merge_tree_settings_sanity_check: [ OK ] 0.42 sec. 2026-10-30 09:51:42 00872_t64_bit_codec: [ OK ] 0.87 sec. 2026-10-30 09:51:42 02734_optimize_group_by: [ OK ] 0.32 sec. 2026-10-30 09:51:43 03215_parsing_archive_name_s3: [ OK ] 0.52 sec. 2026-10-30 09:51:43 03038_nested_dynamic_merges_wide_horizontal: [ SKIPPED ] 0.00 sec. 2026-10-30 09:51:43 Reason: not running for current build 2026-10-30 09:51:43 02932_punycode: [ OK ] 0.72 sec. 2026-10-30 09:51:44 02033_join_engine_deadlock_long: [ OK ] 3.78 sec. 2026-10-30 09:51:44 01515_logtrace_function: [ OK ] 2.23 sec. 2026-10-30 09:51:44 00197_if_fixed_string: [ OK ] 0.37 sec. 2026-10-30 09:51:44 02154_bit_slice_for_fixedstring: [ OK ] 0.82 sec. 2026-10-30 09:51:45 00097_long_storage_buffer_race_condition: [ OK ] 13.56 sec. 2026-10-30 09:51:45 01034_prewhere_max_parallel_replicas_distributed: [ OK ] 0.37 sec. 2026-10-30 09:51:46 01067_join_null: [ OK ] 0.32 sec. 2026-10-30 09:51:46 02477_s3_request_throttler: [ OK ] 3.84 sec. 2026-10-30 09:51:46 00976_system_stop_ttl_merges: [ OK ] 1.37 sec. 2026-10-30 09:51:46 02921_file_engine_size_virtual_column: [ OK ] 2.78 sec. 2026-10-30 09:51:46 00969_columns_clause: [ OK ] 0.37 sec. 2026-10-30 09:51:46 01674_unicode_asan: [ OK ] 0.32 sec. 2026-10-30 09:51:46 01358_mutation_delete_null_rows: [ OK ] 0.37 sec. 2026-10-30 09:51:47 02676_trailing_commas: [ OK ] 0.27 sec. 2026-10-30 09:51:48 02210_processors_profile_log: [ OK ] 1.62 sec. 2026-10-30 09:51:48 01293_client_interactive_vertical_singleline: [ OK ] 2.13 sec. 2026-10-30 09:51:48 02497_source_part_is_intact_when_mutation: [ OK ] 0.37 sec. 2026-10-30 09:51:48 01101_literal_column_clash: [ OK ] 0.37 sec. 2026-10-30 09:51:48 01690_quantilesTiming_ubsan: [ OK ] 0.27 sec. 2026-10-30 09:51:49 02269_bool_map_sync_after_error: [ OK ] 4.48 sec. 2026-10-30 09:51:49 02711_server_uuid_macro: [ OK ] 0.47 sec. 2026-10-30 09:51:49 02841_parallel_final_wrong_columns_order: [ OK ] 1.97 sec. 2026-10-30 09:51:49 01020_function_char: [ OK ] 0.37 sec. 2026-10-30 09:51:49 02791_final_block_structure_mismatch_bug: [ OK ] 0.47 sec. 2026-10-30 09:51:49 01188_attach_table_from_path: [ OK ] 0.42 sec. 2026-10-30 09:51:49 00975_sample_prewhere_distributed: [ OK ] 0.37 sec. 2026-10-30 09:51:50 01273_h3EdgeAngle_range_check: [ OK ] 0.32 sec. 2026-10-30 09:51:50 00500_point_in_polygon: [ OK ] 0.52 sec. 2026-10-30 09:51:50 01353_nullable_tuple: [ OK ] 0.62 sec. 2026-10-30 09:51:51 03150_url_hash_non_constant_level: [ OK ] 0.32 sec. 2026-10-30 09:51:51 02032_short_circuit_least_greatest_bug: [ OK ] 0.27 sec. 2026-10-30 09:51:51 02111_global_context_temporary_tables: [ OK ] 0.37 sec. 2026-10-30 09:51:52 00742_require_join_strictness: [ OK ] 0.27 sec. 2026-10-30 09:51:52 02911_system_symbols: [ OK ] 0.47 sec. 2026-10-30 09:51:52 00726_materialized_view_concurrent: [ OK ] 0.37 sec. 2026-10-30 09:51:53 01356_state_resample: [ OK ] 0.32 sec. 2026-10-30 09:51:53 03037_dynamic_merges_2_horizontal_compact_merge_tree: [ SKIPPED ] 0.00 sec. 2026-10-30 09:51:53 Reason: not running for current build 2026-10-30 09:51:53 03094_one_thousand_joins: [ OK ] 3.78 sec. 2026-10-30 09:51:54 00700_decimal_with_default_precision_and_scale: [ OK ] 0.32 sec. 2026-10-30 09:51:54 00834_kill_mutation_replicated_zookeeper: [ OK ] 40.48 sec. 2026-10-30 09:51:54 02862_sorted_distinct_sparse_fix: [ OK ] 0.27 sec. 2026-10-30 09:51:54 02863_ignore_foreign_keys_in_tables_definition: [ OK ] 0.32 sec. 2026-10-30 09:51:54 00534_functions_bad_arguments1: [ OK ] 5.03 sec. 2026-10-30 09:51:54 00900_orc_arrow_parquet_tuples: [ OK ] 5.73 sec. 2026-10-30 09:51:54 00555_right_join_excessive_rows: [ OK ] 0.27 sec. 2026-10-30 09:51:55 02176_optimize_aggregation_in_order_empty: [ OK ] 0.32 sec. 2026-10-30 09:51:55 02292_nested_not_flattened_detach: [ OK ] 0.32 sec. 2026-10-30 09:51:55 02482_value_block_parsing: [ OK ] 2.18 sec. 2026-10-30 09:51:55 03205_system_sync_replica_format: [ OK ] 0.32 sec. 2026-10-30 09:51:55 02771_jit_functions_comparison_crash: [ OK ] 0.32 sec. 2026-10-30 09:51:55 00085_visible_width_of_tuple_of_dates: [ OK ] 0.32 sec. 2026-10-30 09:51:55 03092_analyzer_same_table_name_in_different_databases: [ OK ] 0.37 sec. 2026-10-30 09:51:56 01474_decimal_scale_bug: [ OK ] 0.32 sec. 2026-10-30 09:51:56 00379_system_processes_port: [ OK ] 1.77 sec. 2026-10-30 09:51:56 01015_empty_in_inner_right_join: [ OK ] 0.52 sec. 2026-10-30 09:51:56 02943_tokenbf_and_ngrambf_indexes_support_match_function: [ OK ] 0.42 sec. 2026-10-30 09:51:56 00938_fix_rwlock_segfault_long: [ OK ] 27.64 sec. 2026-10-30 09:51:56 01535_decimal_round_scale_overflow_check: [ OK ] 0.27 sec. 2026-10-30 09:51:56 03290_final_collapsing: [ OK ] 0.37 sec. 2026-10-30 09:51:56 01746_long_zlib_http_compression_json_format: [ OK ] 2.07 sec. 2026-10-30 09:51:56 01425_decimal_parse_big_negative_exponent: [ OK ] 0.37 sec. 2026-10-30 09:51:57 03162_dynamic_type_nested: [ OK ] 0.32 sec. 2026-10-30 09:51:57 03100_analyzer_constants_in_multiif: [ OK ] 0.27 sec. 2026-10-30 09:51:57 02201_use_skip_indexes_if_final: [ OK ] 0.32 sec. 2026-10-30 09:51:57 02916_replication_protocol_wait_for_part: [ OK ] 10.55 sec. 2026-10-30 09:51:57 00172_constexprs_in_set: [ OK ] 0.32 sec. 2026-10-30 09:51:57 02564_read_in_order_final_desc: [ OK ] 0.32 sec. 2026-10-30 09:51:57 02477_logical_expressions_optimizer_low_cardinality: [ OK ] 0.32 sec. 2026-10-30 09:51:57 00098_f_union_all: [ OK ] 0.32 sec. 2026-10-30 09:51:58 02243_ipv6_long_parsing: [ OK ] 0.32 sec. 2026-10-30 09:51:59 02811_csv_input_field_type_mismatch: [ OK ] 3.08 sec. 2026-10-30 09:51:59 02480_tets_show_full: [ OK ] 2.42 sec. 2026-10-30 09:51:59 01750_parsing_exception: [ OK ] 2.12 sec. 2026-10-30 09:52:00 03169_time_virtual_column: [ OK ] 3.27 sec. 2026-10-30 09:52:00 03006_join_on_inequal_expression_3: [ OK ] 0.47 sec. 2026-10-30 09:52:00 00313_const_totals_extremes: [ OK ] 1.87 sec. 2026-10-30 09:52:01 03198_orc_read_time_zone: [ OK ] 3.13 sec. 2026-10-30 09:52:01 02725_object_column_alter: [ OK ] 0.37 sec. 2026-10-30 09:52:01 03214_backup_and_clear_old_temporary_directories: [ OK ] 4.83 sec. 2026-10-30 09:52:01 03212_max_bytes_to_read_for_schema_inference_in_cache: [ OK ] 2.17 sec. 2026-10-30 09:52:01 01513_optimize_aggregation_in_order_memory_long: [ OK ] 3.79 sec. 2026-10-30 09:52:01 00476_pretty_formats_and_widths: [ OK ] 0.32 sec. 2026-10-30 09:52:01 00740_optimize_predicate_expression: [ OK ] 0.32 sec. 2026-10-30 09:52:01 02992_all_columns_should_have_comment: [ OK ] 0.42 sec. 2026-10-30 09:52:01 00114_float_type_result_of_division: [ OK ] 0.27 sec. 2026-10-30 09:52:01 01881_join_on_conditions_hash: [ OK ] 1.12 sec. 2026-10-30 09:52:02 01186_conversion_to_nullable: [ OK ] 0.32 sec. 2026-10-30 09:52:02 00185_array_literals: [ OK ] 0.37 sec. 2026-10-30 09:52:02 01746_extract_text_from_html: [ OK ] 0.47 sec. 2026-10-30 09:52:02 01470_columns_transformers: [ OK ] 0.57 sec. 2026-10-30 09:52:02 01034_values_parse_float_bug: [ OK ] 3.73 sec. 2026-10-30 09:52:02 02771_tsv_csv_custom_skip_trailing_empty_lines: [ OK ] 0.42 sec. 2026-10-30 09:52:02 02409_url_format_detection: [ OK ] 0.27 sec. 2026-10-30 09:52:03 02864_statistics_ddl: [ OK ] 1.22 sec. 2026-10-30 09:52:03 03152_dynamic_type_simple: [ OK ] 0.37 sec. 2026-10-30 09:52:03 02293_h3_hex_ring: [ OK ] 0.47 sec. 2026-10-30 09:52:03 02681_aggregation_by_partitions_bug: [ OK ] 0.42 sec. 2026-10-30 09:52:04 01474_custom_null_tsv: [ OK ] 3.08 sec. 2026-10-30 09:52:05 01942_snowflakeIDToDateTime: [ OK ] 0.52 sec. 2026-10-30 09:52:05 00358_from_string_complex_types: [ OK ] 0.27 sec. 2026-10-30 09:52:05 00365_statistics_in_formats: [ OK ] 3.63 sec. 2026-10-30 09:52:05 02426_orc_bug: [ OK ] 2.12 sec. 2026-10-30 09:52:05 01070_string_to_h3: [ OK ] 0.27 sec. 2026-10-30 09:52:05 01410_nullable_key_and_index: [ OK ] 0.52 sec. 2026-10-30 09:52:06 02494_optimize_group_by_function_keys_and_alias_columns: [ OK ] 0.37 sec. 2026-10-30 09:52:06 00714_alter_uuid: [ OK ] 0.38 sec. 2026-10-30 09:52:06 02522_different_types_in_storage_merge: [ OK ] 0.32 sec. 2026-10-30 09:52:06 00997_extract_all_crash_6627: [ OK ] 0.27 sec. 2026-10-30 09:52:06 02703_max_local_read_bandwidth: [ OK ] 27.14 sec. 2026-10-30 09:52:06 02374_analyzer_array_join: [ OK ] 0.47 sec. 2026-10-30 09:52:06 02751_text_formats_bad_nullable_parsing: [ OK ] 3.68 sec. 2026-10-30 09:52:06 01849_geoToS2: [ OK ] 0.52 sec. 2026-10-30 09:52:07 03034_dynamic_conversions: [ OK ] 0.52 sec. 2026-10-30 09:52:09 01927_query_views_log_matview_exceptions: [ OK ] 5.65 sec. 2026-10-30 09:52:09 02935_http_content_type_with_http_headers_progress: [ OK ] 6.19 sec. 2026-10-30 09:52:09 02050_clickhouse_local_parsing_exception: [ OK ] 2.08 sec. 2026-10-30 09:52:09 02310_generate_multi_columns_with_uuid: [ OK ] 0.27 sec. 2026-10-30 09:52:09 02908_table_ttl_dependency: [ OK ] 2.58 sec. 2026-10-30 09:52:09 02969_functions_to_subcolumns_if_null: [ OK ] 0.32 sec. 2026-10-30 09:52:09 00041_aggregation_remap: [ OK ] 0.32 sec. 2026-10-30 09:52:10 00779_all_right_join_max_block_size: [ OK ] 0.32 sec. 2026-10-30 09:52:10 00473_output_format_json_quote_denormals: [ OK ] 3.33 sec. 2026-10-30 09:52:10 02354_vector_search_bugs: [ OK ] 0.57 sec. 2026-10-30 09:52:10 02867_null_lc_in_bug: [ OK ] 0.37 sec. 2026-10-30 09:52:10 02340_union_header: [ OK ] 0.32 sec. 2026-10-30 09:52:10 00373_group_by_tuple: [ OK ] 0.32 sec. 2026-10-30 09:52:10 01255_geo_types_livace: [ OK ] 0.32 sec. 2026-10-30 09:52:11 01784_parallel_formatting_memory: [ OK ] 0.37 sec. 2026-10-30 09:52:11 02122_parallel_formatting_Pretty: [ OK ] 4.58 sec. 2026-10-30 09:52:11 03156_default_multiquery_split: [ OK ] 2.43 sec. 2026-10-30 09:52:11 02902_select_subcolumns_from_engine_null: [ OK ] 0.32 sec. 2026-10-30 09:52:11 01942_untuple_transformers_msan: [ OK ] 0.27 sec. 2026-10-30 09:52:12 02984_form_format: [ OK ] 3.13 sec. 2026-10-30 09:52:12 01267_alter_default_key_columns_zookeeper_long: [ OK ] 0.47 sec. 2026-10-30 09:52:13 01037_zookeeper_check_table_empty_pk: [ OK ] 0.37 sec. 2026-10-30 09:52:13 01548_create_table_compound_column_format: [ OK ] 2.28 sec. 2026-10-30 09:52:13 02535_json_bson_each_row_curl: [ OK ] 3.08 sec. 2026-10-30 09:52:13 03164_parallel_replicas_range_filter_min_max: [ OK ] 0.52 sec. 2026-10-30 09:52:14 00204_extract_url_parameter: [ OK ] 0.27 sec. 2026-10-30 09:52:14 02480_analyzer_alias_nullptr: [ OK ] 0.32 sec. 2026-10-30 09:52:14 01475_fix_bigint_shift: [ OK ] 0.32 sec. 2026-10-30 09:52:14 01460_line_as_string_format: [ OK ] 8.20 sec. 2026-10-30 09:52:14 00732_quorum_insert_simple_test_1_parts_zookeeper_long: [ OK ] 0.52 sec. 2026-10-30 09:52:14 02783_date_predicate_optimizations: [ OK ] 1.07 sec. 2026-10-30 09:52:14 02131_row_policies_combination: [ OK ] 0.42 sec. 2026-10-30 09:52:14 03062_analyzer_join_engine_missing_column: [ OK ] 0.32 sec. 2026-10-30 09:52:15 02476_analyzer_join_with_unused_columns: [ OK ] 0.37 sec. 2026-10-30 09:52:15 02864_profile_event_part_lock: [ OK ] 0.37 sec. 2026-10-30 09:52:15 03165_distinct_with_window_func_crash: [ OK ] 0.32 sec. 2026-10-30 09:52:15 00502_string_concat_with_array: [ OK ] 0.27 sec. 2026-10-30 09:52:15 01680_date_time_add_ubsan: [ OK ] 0.47 sec. 2026-10-30 09:52:15 00848_join_use_nulls_segfault: [ OK ] 0.47 sec. 2026-10-30 09:52:16 01498_alter_column_storage_memory: [ OK ] 0.32 sec. 2026-10-30 09:52:16 00981_topK_topKWeighted_long: [ OK ] 5.78 sec. 2026-10-30 09:52:16 01660_join_or_all: [ OK ] 0.62 sec. 2026-10-30 09:52:16 02988_ordinary_database_warning: [ OK ] 0.32 sec. 2026-10-30 09:52:16 02999_variant_suspicious_types: [ OK ] 0.32 sec. 2026-10-30 09:52:16 00416_pocopatch_progress_in_http_headers: [ OK ] 2.07 sec. 2026-10-30 09:52:17 02115_map_contains_analyzer: [ OK ] 0.32 sec. 2026-10-30 09:52:17 02337_check_translate_qualified_names_matcher: [ OK ] 0.32 sec. 2026-10-30 09:52:17 03169_cache_complex_dict_short_circuit_bug: [ OK ] 0.32 sec. 2026-10-30 09:52:17 02784_schema_inference_null_as_default: [ OK ] 0.32 sec. 2026-10-30 09:52:17 02481_default_value_used_in_row_level_filter: [ OK ] 0.37 sec. 2026-10-30 09:52:17 02521_tsv_csv_custom_header_detection: [ OK ] 16.12 sec. 2026-10-30 09:52:18 02962_parallel_window_functions_different_partitioning: [ OK ] 0.32 sec. 2026-10-30 09:52:18 02002_system_table_with_tuple: [ OK ] 2.03 sec. 2026-10-30 09:52:18 00953_indices_alter_exceptions: [ OK ] 2.98 sec. 2026-10-30 09:52:18 00321_pk_set: [ OK ] 0.37 sec. 2026-10-30 09:52:18 00757_enum_defaults_const: [ OK ] 0.32 sec. 2026-10-30 09:52:18 02345_create_table_allow_trailing_comma: [ OK ] 0.32 sec. 2026-10-30 09:52:18 02840_grace_hash_join_structure_mismatch: [ OK ] 0.32 sec. 2026-10-30 09:52:18 03155_datasketches_ubsan: [ OK ] 0.27 sec. 2026-10-30 09:52:18 02293_h3_line: [ OK ] 0.37 sec. 2026-10-30 09:52:19 03120_analyzer_param_in_CTE_alias: [ OK ] 0.32 sec. 2026-10-30 09:52:19 00453_cast_enum: [ OK ] 0.32 sec. 2026-10-30 09:52:19 03038_nested_dynamic_merges_small: [ OK ] 1.07 sec. 2026-10-30 09:52:19 02998_analyzer_secret_args_tree_node: [ OK ] 0.27 sec. 2026-10-30 09:52:20 01607_arrays_as_nested_csv: [ OK ] 2.98 sec. 2026-10-30 09:52:20 02021_h3_is_res_classIII: [ OK ] 0.37 sec. 2026-10-30 09:52:20 02875_final_invalid_read_ranges_bug: [ OK ] 0.37 sec. 2026-10-30 09:52:20 02578_ipv4_codec_t64: [ OK ] 0.27 sec. 2026-10-30 09:52:20 01532_having_with_totals: [ OK ] 0.37 sec. 2026-10-30 09:52:20 02158_proportions_ztest_cmp: [ OK ] 2.68 sec. 2026-10-30 09:52:21 02876_yyyymmddtodate: [ OK ] 0.67 sec. 2026-10-30 09:52:21 01009_global_array_join_names: [ OK ] 0.32 sec. 2026-10-30 09:52:21 00523_aggregate_functions_in_group_array: [ OK ] 0.27 sec. 2026-10-30 09:52:21 01058_window_view_event_hop_to_strict_asc: [ OK ] 3.53 sec. 2026-10-30 09:52:21 02514_bad_index_granularity: [ OK ] 0.32 sec. 2026-10-30 09:52:21 00560_float_leading_plus_in_exponent: [ OK ] 0.27 sec. 2026-10-30 09:52:21 01506_buffer_table_alter_block_structure: [ OK ] 0.32 sec. 2026-10-30 09:52:21 02532_send_logs_level_test: [ OK ] 2.83 sec. 2026-10-30 09:52:21 00732_quorum_insert_simple_test_2_parts_zookeeper_long: [ OK ] 0.42 sec. 2026-10-30 09:52:22 03159_dynamic_type_all_types: [ OK ] 0.62 sec. 2026-10-30 09:52:22 01903_correct_block_size_prediction_with_default: [ OK ] 10.65 sec. 2026-10-30 09:52:22 02317_distinct_in_order_optimization: [ OK ] 1.02 sec. 2026-10-30 09:52:22 01017_in_unconvertible_complex_type: [ OK ] 0.37 sec. 2026-10-30 09:52:23 00829_bitmap64_function: [ OK ] 0.42 sec. 2026-10-30 09:52:23 01551_mergetree_read_in_order_spread: [ OK ] 0.37 sec. 2026-10-30 09:52:23 02907_clickhouse_dictionary_bug: [ OK ] 2.08 sec. 2026-10-30 09:52:23 01069_database_memory: [ OK ] 0.37 sec. 2026-10-30 09:52:24 03215_toStartOfWeek_with_dateTime64_fix: [ OK ] 0.27 sec. 2026-10-30 09:52:24 00980_zookeeper_merge_tree_alter_settings: [ OK ] 0.77 sec. 2026-10-30 09:52:24 03003_prql_panic: [ OK ] 2.02 sec. 2026-10-30 09:52:24 00825_protobuf_format_splitted_nested: [ OK ] 3.28 sec. 2026-10-30 09:52:25 02022_storage_filelog_one_file: [ OK ] 3.98 sec. 2026-10-30 09:52:25 02869_http_headers_elapsed_ns: [ OK ] 1.88 sec. 2026-10-30 09:52:25 00334_column_aggregate_function_limit: [ OK ] 0.33 sec. 2026-10-30 09:52:25 02941_variant_type_4: [ OK ] 14.21 sec. 2026-10-30 09:52:25 03161_lightweight_delete_projection: [ OK ] 0.42 sec. 2026-10-30 09:52:26 02900_matview_create_to_errors: [ OK ] 1.97 sec. 2026-10-30 09:52:26 02456_keeper_retries_during_insert: [ OK ] 1.67 sec. 2026-10-30 09:52:26 00134_aggregation_by_fixed_string_of_size_1_2_4_8: [ OK ] 0.32 sec. 2026-10-30 09:52:26 01825_new_type_json_in_array: [ OK ] 0.47 sec. 2026-10-30 09:52:26 00205_scalar_subqueries: [ OK ] 0.42 sec. 2026-10-30 09:52:26 00799_function_dry_run: [ OK ] 0.32 sec. 2026-10-30 09:52:27 02341_global_join_cte: [ OK ] 0.42 sec. 2026-10-30 09:52:27 00685_output_format_json_escape_forward_slashes: [ OK ] 0.27 sec. 2026-10-30 09:52:27 01047_no_alias_columns_with_table_aliases: [ OK ] 0.37 sec. 2026-10-30 09:52:27 02504_regexp_dictionary_ua_parser: [ OK ] 3.43 sec. 2026-10-30 09:52:27 01307_polygon_perimeter: [ OK ] 0.27 sec. 2026-10-30 09:52:27 02426_pod_array_overflow_2: [ OK ] 0.27 sec. 2026-10-30 09:52:28 02893_bad_sample_view: [ OK ] 0.27 sec. 2026-10-30 09:52:28 02915_analyzer_fuzz_6: [ OK ] 0.37 sec. 2026-10-30 09:52:28 01225_drop_dictionary_as_table: [ OK ] 0.32 sec. 2026-10-30 09:52:28 00499_json_enum_insert: [ OK ] 0.32 sec. 2026-10-30 09:52:28 00266_read_overflow_mode: [ OK ] 0.32 sec. 2026-10-30 09:52:29 02495_concat_with_separator: [ OK ] 0.57 sec. 2026-10-30 09:52:29 03680_loop_table_function_access_check: [ OK ] 3.18 sec. 2026-10-30 09:52:29 02833_sparse_columns_tuple_function: [ OK ] 0.32 sec. 2026-10-30 09:52:29 03077_analyzer_multi_scalar_subquery_aliases: [ OK ] 0.27 sec. 2026-10-30 09:52:29 03261_json_hints_types_check: [ OK ] 0.42 sec. 2026-10-30 09:52:29 02889_print_pretty_type_names: [ OK ] 0.32 sec. 2026-10-30 09:52:29 01273_arrow_nullable_arrays_load: [ OK ] 3.63 sec. 2026-10-30 09:52:29 01825_new_type_json_multiple_files: [ OK ] 5.49 sec. 2026-10-30 09:52:29 02275_full_sort_join_long: [ SKIPPED ] 0.00 sec. 2026-10-30 09:52:29 Reason: not running for current build 2026-10-30 09:52:30 00997_trim: [ OK ] 0.47 sec. 2026-10-30 09:52:30 03060_analyzer_regular_view_alias: [ OK ] 0.32 sec. 2026-10-30 09:52:30 02770_jit_aggregation_nullable_key_fix: [ OK ] 0.57 sec. 2026-10-30 09:52:30 02236_json_each_row_empty_map_schema_inference: [ OK ] 0.27 sec. 2026-10-30 09:52:30 02428_index_analysis_with_null_literal: [ OK ] 0.87 sec. 2026-10-30 09:52:30 01605_drop_settings_profile_while_assigned: [ OK ] 0.32 sec. 2026-10-30 09:52:30 02122_parallel_formatting_Markdown: [ OK ] 3.23 sec. 2026-10-30 09:52:30 02158_proportions_ztest: [ OK ] 0.32 sec. 2026-10-30 09:52:30 01576_alias_column_rewrite: [ OK ] 0.63 sec. 2026-10-30 09:52:30 02473_multistep_prewhere: [ OK ] 11.20 sec. 2026-10-30 09:52:30 00688_low_cardinality_defaults: [ OK ] 0.27 sec. 2026-10-30 09:52:30 00154_shard_distributed_with_distinct: [ OK ] 0.27 sec. 2026-10-30 09:52:30 00041_big_array_join: [ OK ] 0.42 sec. 2026-10-30 09:52:31 02346_to_hour_monotonicity_fix: [ OK ] 0.37 sec. 2026-10-30 09:52:31 03246_alter_update_dynamic_hung: [ OK ] 0.67 sec. 2026-10-30 09:52:31 01769_extended_range_2: [ OK ] 0.32 sec. 2026-10-30 09:52:31 02400_memory_accounting_on_error: [ OK ] 0.47 sec. 2026-10-30 09:52:31 02294_decimal_second_errors: [ OK ] 0.27 sec. 2026-10-30 09:52:31 02366_kql_tabular: [ OK ] 0.47 sec. 2026-10-30 09:52:31 03153_dynamic_type_empty: [ OK ] 0.32 sec. 2026-10-30 09:52:31 02021_map_bloom_filter_index: [ OK ] 0.57 sec. 2026-10-30 09:52:31 02179_bool_type: [ OK ] 0.37 sec. 2026-10-30 09:52:31 01256_misspell_layout_name_podshumok: [ OK ] 0.27 sec. 2026-10-30 09:52:32 02006_todatetime64_from_string: [ OK ] 0.32 sec. 2026-10-30 09:52:32 02901_analyzer_recursive_window: [ OK ] 0.32 sec. 2026-10-30 09:52:32 00596_limit_on_expanded_ast: [ OK ] 2.07 sec. 2026-10-30 09:52:32 02871_clickhouse_client_restart_pager: [ OK ] 2.12 sec. 2026-10-30 09:52:32 02943_order_by_all: [ OK ] 0.52 sec. 2026-10-30 09:52:32 00661_optimize_final_replicated_without_partition_zookeeper: [ OK ] 0.52 sec. 2026-10-30 09:52:32 02124_insert_deduplication_token_materialized_views: [ OK ] 1.17 sec. 2026-10-30 09:52:33 02354_read_in_order_prewhere: [ OK ] 0.72 sec. 2026-10-30 09:52:33 02165_h3_num_hexagons: [ OK ] 0.37 sec. 2026-10-30 09:52:33 00118_storage_join: [ OK ] 0.42 sec. 2026-10-30 09:52:33 02515_projections_with_totals: [ OK ] 0.32 sec. 2026-10-30 09:52:34 02315_pmj_union_ubsan_35857: [ OK ] 0.32 sec. 2026-10-30 09:52:34 03169_display_column_names_in_footer: [ OK ] 0.42 sec. 2026-10-30 09:52:34 02782_avro_decimals: [ OK ] 2.33 sec. 2026-10-30 09:52:34 03037_dynamic_merges_2_horizontal_wide_merge_tree: [ SKIPPED ] 0.00 sec. 2026-10-30 09:52:34 Reason: not running for current build 2026-10-30 09:52:34 03222_json_squashing: [ OK ] 1.52 sec. 2026-10-30 09:52:34 02481_analyzer_optimize_grouping_sets_keys: [ OK ] 0.32 sec. 2026-10-30 09:52:34 00980_merge_alter_settings: [ OK ] 0.52 sec. 2026-10-30 09:52:34 02146_mv_non_phys: [ OK ] 0.32 sec. 2026-10-30 09:52:34 03119_analyzer_window_function_in_CTE_alias: [ OK ] 0.32 sec. 2026-10-30 09:52:35 00753_alter_attach: [ OK ] 0.87 sec. 2026-10-30 09:52:35 02956_clickhouse_local_system_parts: [ OK ] 2.13 sec. 2026-10-30 09:52:35 02861_join_on_nullsafe_compare: [ OK ] 0.82 sec. 2026-10-30 09:52:35 03130_analyzer_self_join_group_by: [ OK ] 0.32 sec. 2026-10-30 09:52:35 02842_filesystem_cache_validate_path: [ OK ] 0.32 sec. 2026-10-30 09:52:35 02276_full_sort_join_unsupported: [ OK ] 0.42 sec. 2026-10-30 09:52:35 00209_insert_select_extremes: [ OK ] 0.37 sec. 2026-10-30 09:52:36 00753_distributed_system_columns_and_system_tables: [ OK ] 0.32 sec. 2026-10-30 09:52:36 01782_field_oom: [ OK ] 1.37 sec. 2026-10-30 09:52:36 02343_aggregation_pipeline: [ OK ] 0.47 sec. 2026-10-30 09:52:36 01785_pmj_lc_bug: [ OK ] 0.42 sec. 2026-10-30 09:52:36 02417_null_variadic_behaviour: [ OK ] 0.82 sec. 2026-10-30 09:52:37 01098_sum: [ OK ] 0.37 sec. 2026-10-30 09:52:37 03224_json_merges_new_type_in_shared_data: [ OK ] 0.37 sec. 2026-10-30 09:52:37 02374_combine_multi_if_and_count_if_opt: [ OK ] 0.32 sec. 2026-10-30 09:52:37 01710_projections_optimize_aggregation_in_order: [ OK ] 5.68 sec. 2026-10-30 09:52:37 01753_optimize_aggregation_in_order: [ OK ] 2.17 sec. 2026-10-30 09:52:37 02790_fix_coredump_when_compile_expression: [ OK ] 0.32 sec. 2026-10-30 09:52:37 01753_mutate_table_predicated_with_table: [ OK ] 0.42 sec. 2026-10-30 09:52:38 01499_log_deadlock: [ OK ] 0.37 sec. 2026-10-30 09:52:38 01139_asof_join_types: [ OK ] 0.42 sec. 2026-10-30 09:52:38 02293_http_header_summary_contains_exception_code_with_progress: [ OK ] 3.68 sec. 2026-10-30 09:52:38 00936_crc_functions: [ OK ] 0.32 sec. 2026-10-30 09:52:38 03006_mv_deduplication_throw_if_async_insert: [ OK ] 0.67 sec. 2026-10-30 09:52:38 02531_ipv4_arithmetic: [ OK ] 0.32 sec. 2026-10-30 09:52:39 02382_analyzer_matcher_join_using: [ OK ] 0.47 sec. 2026-10-30 09:52:39 01710_normal_projection_with_query_plan_optimization: [ OK ] 0.37 sec. 2026-10-30 09:52:39 02267_empty_arrays_read_reverse: [ OK ] 0.62 sec. 2026-10-30 09:52:39 02244_make_datetime: [ OK ] 0.42 sec. 2026-10-30 09:52:40 02986_leftpad_fixedstring: [ OK ] 0.32 sec. 2026-10-30 09:52:40 01201_drop_column_compact_part_replicated_zookeeper_long: [ OK ] 0.72 sec. 2026-10-30 09:52:40 01010_partial_merge_join: [ OK ] 1.07 sec. 2026-10-30 09:52:40 02324_compatibility_setting: [ OK ] 3.93 sec. 2026-10-30 09:52:40 01035_prewhere_with_alias: [ OK ] 0.32 sec. 2026-10-30 09:52:40 00487_if_array_fixed_string: [ OK ] 0.32 sec. 2026-10-30 09:52:40 02540_date_column_consistent_insert_behaviour: [ OK ] 0.57 sec. 2026-10-30 09:52:40 02895_npy_format: [ OK ] 15.06 sec. 2026-10-30 09:52:41 02746_index_analysis_binary_operator_with_null: [ OK ] 0.33 sec. 2026-10-30 09:52:41 03207_json_read_subcolumns_1_memory: [ OK ] 0.92 sec. 2026-10-30 09:52:41 03287_dynamic_and_json_squashing_fix: [ OK ] 0.42 sec. 2026-10-30 09:52:41 02997_projections_formatting: [ OK ] 0.27 sec. 2026-10-30 09:52:41 02354_tuple_element_with_default: [ OK ] 0.32 sec. 2026-10-30 09:52:42 00276_sample: [ OK ] 1.27 sec. 2026-10-30 09:52:42 00357_to_string_complex_types: [ OK ] 0.32 sec. 2026-10-30 09:52:42 02007_join_use_nulls: [ OK ] 0.32 sec. 2026-10-30 09:52:43 01780_column_sparse_filter: [ OK ] 0.42 sec. 2026-10-30 09:52:43 03127_argMin_combinator_state: [ OK ] 0.32 sec. 2026-10-30 09:52:43 02122_parallel_formatting_JSON: [ OK ] 3.73 sec. 2026-10-30 09:52:44 02705_settings_check_changed_flag: [ OK ] 0.47 sec. 2026-10-30 09:52:44 00563_shard_insert_into_remote: [ OK ] 0.37 sec. 2026-10-30 09:52:44 02122_parallel_formatting_JSONCompactStrings: [ OK ] 3.48 sec. 2026-10-30 09:52:44 01051_aggregate_function_crash: [ OK ] 0.32 sec. 2026-10-30 09:52:44 00746_hashing_tuples: [ OK ] 0.37 sec. 2026-10-30 09:52:44 02426_to_string_nullable_fixedstring: [ OK ] 0.32 sec. 2026-10-30 09:52:45 01710_projection_with_column_transformers: [ OK ] 0.32 sec. 2026-10-30 09:52:45 03144_asof_join_ddb_doubles: [ OK ] 0.37 sec. 2026-10-30 09:52:45 01945_show_debug_warning: [ OK ] 3.98 sec. 2026-10-30 09:52:45 01797_StripeLog_rwlock_ub: [ OK ] 0.32 sec. 2026-10-30 09:52:46 02918_implicit_sign_column_constraints_for_collapsing_engine: [ OK ] 4.73 sec. 2026-10-30 09:52:46 03165_order_by_duplicate: [ OK ] 0.32 sec. 2026-10-30 09:52:46 00361_shared_array_offsets_and_squash_blocks: [ OK ] 0.32 sec. 2026-10-30 09:52:46 02525_analyzer_function_in_crash_fix: [ OK ] 0.32 sec. 2026-10-30 09:52:46 00564_temporary_table_management: [ OK ] 0.32 sec. 2026-10-30 09:52:47 02346_read_in_order_fixed_prefix: [ OK ] 10.15 sec. 2026-10-30 09:52:47 03208_array_of_json_read_subcolumns_1: [ OK ] 3.18 sec. 2026-10-30 09:52:48 01923_ttl_with_modify_column: [ OK ] 0.42 sec. 2026-10-30 09:52:48 03010_sum_to_to_count_if_nullable: [ OK ] 0.32 sec. 2026-10-30 09:52:48 01581_deduplicate_by_columns_replicated_long: [ OK ] 0.62 sec. 2026-10-30 09:52:49 02332_dist_insert_send_logs_level: [ OK ] 2.33 sec. 2026-10-30 09:52:49 02319_sql_standard_create_drop_index: [ OK ] 0.47 sec. 2026-10-30 09:52:50 02507_to_unix_timestamp_overflow: [ OK ] 0.37 sec. 2026-10-30 09:52:50 02990_format_select_from_explain: [ OK ] 2.02 sec. 2026-10-30 09:52:50 02473_multistep_split_prewhere: [ OK ] 12.80 sec. 2026-10-30 09:52:50 02444_async_broken_outdated_part_loading: [ OK ] 6.08 sec. 2026-10-30 09:52:50 00048_a_stored_aggregates_merge: [ OK ] 0.42 sec. 2026-10-30 09:52:50 02375_scalar_lc_cte: [ OK ] 0.27 sec. 2026-10-30 09:52:50 01605_key_condition_enum_int: [ OK ] 0.32 sec. 2026-10-30 09:52:50 02174_cte_scalar_cache: [ OK ] 0.67 sec. 2026-10-30 09:52:50 02517_uuid_parsing: [ OK ] 0.32 sec. 2026-10-30 09:52:50 01773_datetime64_add_ubsan: [ OK ] 0.27 sec. 2026-10-30 09:52:51 02479_analyzer_aggregation_crash: [ OK ] 0.32 sec. 2026-10-30 09:52:51 00927_asof_join_noninclusive: [ OK ] 0.37 sec. 2026-10-30 09:52:51 01076_json_each_row_array: [ OK ] 2.37 sec. 2026-10-30 09:52:51 02471_wrong_date_monotonicity: [ OK ] 0.32 sec. 2026-10-30 09:52:51 01913_names_of_tuple_literal: [ OK ] 0.32 sec. 2026-10-30 09:52:51 01770_extended_range_3: [ OK ] 0.32 sec. 2026-10-30 09:52:51 01451_replicated_detach_drop_and_quorum_long: [ OK ] 0.57 sec. 2026-10-30 09:52:51 03038_nested_dynamic_merges_compact_vertical: [ SKIPPED ] 0.00 sec. 2026-10-30 09:52:51 Reason: not running for current build 2026-10-30 09:52:51 02933_ephemeral_mv: [ OK ] 0.32 sec. 2026-10-30 09:52:51 01451_replicated_detach_drop_part_long: [ OK ] 0.57 sec. 2026-10-30 09:52:52 02124_insert_deduplication_token: [ OK ] 0.37 sec. 2026-10-30 09:52:52 01666_date_lut_buffer_overflow: [ OK ] 0.27 sec. 2026-10-30 09:52:52 02679_query_parameters_dangling_pointer: [ OK ] 0.32 sec. 2026-10-30 09:52:52 01323_if_with_nulls: [ OK ] 0.47 sec. 2026-10-30 09:52:53 01917_prewhere_column_type: [ OK ] 0.82 sec. 2026-10-30 09:52:54 03008_filter_projections_non_deterministoc_functions: [ OK ] 1.19 sec. 2026-10-30 09:52:54 00940_max_parts_in_total: [ OK ] 0.59 sec. 2026-10-30 09:52:57 02158_ztest_cmp: [ OK ] 5.24 sec. 2026-10-30 09:52:58 01655_agg_if_nullable: [ OK ] 0.74 sec. 2026-10-30 09:52:58 02414_all_new_table_functions_must_be_documented: [ OK ] 0.64 sec. 2026-10-30 09:52:59 01273_arrow_nested_arrays_load: [ OK ] 7.29 sec. 2026-10-30 09:52:59 02128_cast_nullable: [ OK ] 0.68 sec. 2026-10-30 09:52:59 02456_test_zero_copy_mutation: [ OK ] 0.68 sec. 2026-10-30 09:53:00 02353_partition_prune_nullable_key: [ OK ] 0.63 sec. 2026-10-30 09:53:00 00988_constraints_replication_zookeeper_long: [ OK ] 0.81 sec. 2026-10-30 09:53:01 02891_alter_update_adaptive_granularity: [ OK ] 0.68 sec. 2026-10-30 09:53:01 02271_replace_partition_many_tables: [ OK ] 30.55 sec. 2026-10-30 09:53:01 02875_merge_engine_set_index: [ OK ] 6.80 sec. 2026-10-30 09:53:01 00299_stripe_log_multiple_inserts: [ OK ] 0.79 sec. 2026-10-30 09:53:01 02113_untuple_func_alias: [ OK ] 0.78 sec. 2026-10-30 09:53:02 00732_base64_functions: [ OK ] 0.63 sec. 2026-10-30 09:53:02 03203_optimize_disjunctions_chain_to_in: [ OK ] 0.79 sec. 2026-10-30 09:53:03 01428_h3_range_check: [ OK ] 0.72 sec. 2026-10-30 09:53:03 01825_new_type_json_insert_select: [ OK ] 1.21 sec. 2026-10-30 09:53:04 02813_func_today_and_alias: [ OK ] 0.37 sec. 2026-10-30 09:53:04 00148_summing_merge_tree_aggregate_function: [ OK ] 1.64 sec. 2026-10-30 09:53:05 01104_distributed_one_test: [ OK ] 0.75 sec. 2026-10-30 09:53:06 02490_replacing_merge_tree_is_deleted_column: [ OK ] 1.67 sec. 2026-10-30 09:53:09 02476_analyzer_identifier_hints: [ OK ] 23.01 sec. 2026-10-30 09:53:09 02714_async_inserts_empty_data: [ OK ] 8.23 sec. 2026-10-30 09:53:09 01431_utf8_ubsan: [ OK ] 0.63 sec. 2026-10-30 09:53:09 02883_zookeeper_finalize_stress: [ OK ] 19.18 sec. 2026-10-30 09:53:10 02941_variant_type_1: [ OK ] 23.48 sec. 2026-10-30 09:53:10 00230_array_functions_has_count_equal_index_of_non_const_second_arg: [ OK ] 0.49 sec. 2026-10-30 09:53:10 03152_analyzer_columns_list: [ OK ] 0.32 sec. 2026-10-30 09:53:10 01492_format_readable_quantity: [ OK ] 0.27 sec. 2026-10-30 09:53:10 03073_analyzer_alias_as_column_name: [ OK ] 0.32 sec. 2026-10-30 09:53:10 00105_shard_collations: [ OK ] 0.52 sec. 2026-10-30 09:53:10 00739_array_element_nullable_string_mattrobenolt: [ OK ] 0.32 sec. 2026-10-30 09:53:10 02731_parallel_replicas_join_subquery: [ OK ] 0.97 sec. 2026-10-30 09:53:10 02477_exists_fuzz_43478: [ OK ] 0.32 sec. 2026-10-30 09:53:11 02524_fuzz_and_fuss: [ OK ] 0.32 sec. 2026-10-30 09:53:11 00534_functions_bad_arguments2: [ OK ] 9.08 sec. 2026-10-30 09:53:11 00688_low_cardinality_alter_add_column: [ OK ] 0.32 sec. 2026-10-30 09:53:11 02366_kql_create_table: [ OK ] 0.37 sec. 2026-10-30 09:53:11 02915_analyzer_fuzz_5: [ OK ] 0.32 sec. 2026-10-30 09:53:11 03016_analyzer_groupby_fuzz_59796: [ OK ] 0.27 sec. 2026-10-30 09:53:11 00558_parse_floats: [ OK ] 0.32 sec. 2026-10-30 09:53:11 01825_new_type_json_9: [ OK ] 0.37 sec. 2026-10-30 09:53:12 01040_distributed_background_insert_batch_inserts: [ OK ] 0.47 sec. 2026-10-30 09:53:12 03047_analyzer_alias_join: [ OK ] 0.27 sec. 2026-10-30 09:53:12 01041_h3_is_valid: [ OK ] 0.27 sec. 2026-10-30 09:53:12 02476_query_parameters_without_serialisation: [ OK ] 0.32 sec. 2026-10-30 09:53:13 03038_recursive_cte_postgres_4: [ OK ] 0.37 sec. 2026-10-30 09:53:13 01852_s2_get_neighbours: [ OK ] 0.27 sec. 2026-10-30 09:53:13 00029_test_zookeeper_optimize_exception: [ OK ] 7.16 sec. 2026-10-30 09:53:14 01567_system_processes_current_database: [ OK ] 0.27 sec. 2026-10-30 09:53:14 03034_normalized_ast: [ OK ] 0.32 sec. 2026-10-30 09:53:14 00234_disjunctive_equality_chains_optimization: [ OK ] 0.32 sec. 2026-10-30 09:53:15 03208_uniq_with_empty_tuple: [ OK ] 0.32 sec. 2026-10-30 09:53:15 02845_table_function_hdfs_filter_by_virtual_columns: [ OK ] 3.83 sec. 2026-10-30 09:53:15 01497_now_support_timezone: [ OK ] 0.27 sec. 2026-10-30 09:53:15 00508_materialized_view_to: [ OK ] 0.32 sec. 2026-10-30 09:53:15 01403_datetime64_constant_arg: [ OK ] 0.27 sec. 2026-10-30 09:53:16 00757_enum_defaults_const_analyzer: [ OK ] 0.32 sec. 2026-10-30 09:53:16 00268_aliases_without_as_keyword: [ OK ] 0.32 sec. 2026-10-30 09:53:16 00814_parsing_ub: [ OK ] 0.32 sec. 2026-10-30 09:53:17 00618_nullable_in: [ OK ] 0.32 sec. 2026-10-30 09:53:17 02967_parallel_replicas_join_algo_and_analyzer_1: [ OK ] 5.88 sec. 2026-10-30 09:53:18 01773_min_max_time_system_parts_datetime64: [ OK ] 0.27 sec. 2026-10-30 09:53:18 01671_aggregate_function_group_bitmap_data: [ OK ] 0.32 sec. 2026-10-30 09:53:18 02903_client_insert_in_background: [ OK ] 2.88 sec. 2026-10-30 09:53:18 02561_sorting_constants_and_distinct_crash: [ OK ] 5.03 sec. 2026-10-30 09:53:18 01960_lambda_precedence: [ OK ] 0.32 sec. 2026-10-30 09:53:18 02313_test_fpc_codec: [ OK ] 0.47 sec. 2026-10-30 09:53:19 01273_arrow_stream: [ OK ] 26.63 sec. 2026-10-30 09:53:20 01039_mergetree_exec_time: [ OK ] 1.37 sec. 2026-10-30 09:53:20 00396_uuid: [ OK ] 0.37 sec. 2026-10-30 09:53:20 01417_update_permutation_crash: [ OK ] 0.27 sec. 2026-10-30 09:53:20 02968_full_sorting_join_fuzz: [ OK ] 2.12 sec. 2026-10-30 09:53:21 01881_to_week_monotonic_fix: [ OK ] 0.32 sec. 2026-10-30 09:53:21 02479_nullable_primary_key_non_first_column: [ OK ] 0.32 sec. 2026-10-30 09:53:21 01230_join_get_truncate: [ OK ] 0.32 sec. 2026-10-30 09:53:22 01502_bar_overflow: [ OK ] 0.77 sec. 2026-10-30 09:53:23 02815_alias_to_length: [ OK ] 0.43 sec. 2026-10-30 09:53:23 02221_parallel_replicas_bug: [ OK ] 3.49 sec. 2026-10-30 09:53:24 00700_decimal_null: [ OK ] 0.85 sec. 2026-10-30 09:53:25 02995_forget_partition: [ OK ] 14.62 sec. 2026-10-30 09:53:25 03036_reading_s3_archives: [ OK ] 1.05 sec. 2026-10-30 09:53:26 02006_client_test_hint_error_name: [ OK ] 0.38 sec. 2026-10-30 09:53:26 02959_system_database_engines: [ OK ] 0.52 sec. 2026-10-30 09:53:27 02025_subcolumns_compact_parts: [ OK ] 0.58 sec. 2026-10-30 09:53:28 02015_async_inserts_7: [ OK ] 5.21 sec. 2026-10-30 09:53:28 02861_alter_replace_partition_do_not_wait_mutations_on_unrelated_partitions: [ OK ] 7.53 sec. 2026-10-30 09:53:29 01786_group_by_pk_many_streams: [ OK ] 0.72 sec. 2026-10-30 09:53:29 01699_timezoneOffset: [ OK ] 0.74 sec. 2026-10-30 09:53:29 02003_memory_limit_in_client: [ OK ] 10.92 sec. 2026-10-30 09:53:30 01319_query_formatting_in_server_log: [ OK ] 0.89 sec. 2026-10-30 09:53:30 00931_low_cardinality_nullable_aggregate_function_type: [ OK ] 1.03 sec. 2026-10-30 09:53:30 01818_move_partition_simple: [ OK ] 0.83 sec. 2026-10-30 09:53:31 02874_analysis_of_variance_overflow: [ OK ] 0.54 sec. 2026-10-30 09:53:31 02160_h3_cell_area_m2: [ OK ] 0.55 sec. 2026-10-30 09:53:31 02680_illegal_type_of_filter_projection: [ OK ] 0.48 sec. 2026-10-30 09:53:33 02367_analyzer_table_alias_columns: [ OK ] 1.33 sec. 2026-10-30 09:53:37 01731_async_task_queue_wait: [ OK ] 6.23 sec. 2026-10-30 09:53:37 02843_backup_use_same_password_for_base_backup: [ OK ] 9.85 sec. 2026-10-30 09:53:38 02189_join_type_conversion: [ OK ] 0.54 sec. 2026-10-30 09:53:38 02844_max_backup_bandwidth_s3: [ OK ] 32.88 sec. 2026-10-30 09:53:38 02241_parquet_bad_column: [ OK ] 8.07 sec. 2026-10-30 09:53:38 03053_analyzer_join_alias: [ OK ] 0.58 sec. 2026-10-30 09:53:39 00384_column_aggregate_function_insert_from: [ OK ] 0.54 sec. 2026-10-30 09:53:39 03142_window_function_limit_by: [ OK ] 0.63 sec. 2026-10-30 09:53:39 01509_check_many_parallel_quorum_inserts_long: [ OK ] 13.56 sec. 2026-10-30 09:53:39 02812_pointwise_array_operations: [ OK ] 0.63 sec. 2026-10-30 09:53:39 00746_compile_non_deterministic_function: [ OK ] 6.66 sec. 2026-10-30 09:53:40 02763_row_policy_storage_merge_alias: [ OK ] 0.85 sec. 2026-10-30 09:53:40 00604_show_create_database: [ OK ] 0.43 sec. 2026-10-30 09:53:40 03247_generic_arrayMin_arrayMax_fixes: [ OK ] 0.53 sec. 2026-10-30 09:53:40 01459_default_value_of_argument_type_nullptr_dereference: [ OK ] 0.58 sec. 2026-10-30 09:53:40 02876_yyyymmddhhmmsstodatetime: [ OK ] 1.64 sec. 2026-10-30 09:53:40 00218_like_regexp_newline: [ OK ] 0.59 sec. 2026-10-30 09:53:41 01666_gcd_ubsan: [ OK ] 0.73 sec. 2026-10-30 09:53:41 02493_analyzer_table_functions_untuple: [ OK ] 0.69 sec. 2026-10-30 09:53:41 01603_decimal_mult_float: [ OK ] 0.74 sec. 2026-10-30 09:53:41 03165_parseReadableSize: [ OK ] 1.00 sec. 2026-10-30 09:53:41 02933_sqid: [ OK ] 4.00 sec. 2026-10-30 09:53:41 03202_dynamic_null_map_subcolumn: [ OK ] 1.65 sec. 2026-10-30 09:53:42 02782_values_null_to_lc_nullable: [ OK ] 0.49 sec. 2026-10-30 09:53:42 00053_all_inner_join: [ OK ] 0.53 sec. 2026-10-30 09:53:42 01069_insert_float_as_nullable_unit8: [ OK ] 0.45 sec. 2026-10-30 09:53:42 02311_system_zookeeper_insert: [ OK ] 0.69 sec. 2026-10-30 09:53:42 02693_multiple_joins_in: [ OK ] 0.43 sec. 2026-10-30 09:53:42 00542_access_to_temporary_table_in_readonly_mode: [ OK ] 0.42 sec. 2026-10-30 09:53:42 02095_function_get_os_kernel_version: [ OK ] 0.38 sec. 2026-10-30 09:53:42 00513_fractional_time_zones: [ OK ] 0.53 sec. 2026-10-30 09:53:42 01527_bad_aggregation_in_lambda: [ OK ] 0.43 sec. 2026-10-30 09:53:42 02366_asof_optimize_predicate_bug_37813: [ OK ] 0.49 sec. 2026-10-30 09:53:42 00929_multi_match_edit_distance: [ OK ] 1.30 sec. 2026-10-30 09:53:43 02902_topKGeneric_deserialization_memory: [ OK ] 0.43 sec. 2026-10-30 09:53:43 01457_int256_hashing: [ OK ] 0.69 sec. 2026-10-30 09:53:44 01461_query_start_time_microseconds: [ OK ] 1.44 sec. 2026-10-30 09:53:44 01143_trivial_count_with_join: [ OK ] 0.59 sec. 2026-10-30 09:53:44 03156_group_concat: [ OK ] 1.29 sec. 2026-10-30 09:53:44 02477_age_datetime64: [ OK ] 0.63 sec. 2026-10-30 09:53:45 01074_h3_range_check: [ OK ] 0.65 sec. 2026-10-30 09:53:45 00610_materialized_view_forward_alter_partition_statements: [ OK ] 0.63 sec. 2026-10-30 09:53:45 01301_polygons_within: [ OK ] 0.55 sec. 2026-10-30 09:53:46 00586_removing_unused_columns_from_subquery: [ OK ] 0.64 sec. 2026-10-30 09:53:46 02192_comment: [ OK ] 0.59 sec. 2026-10-30 09:53:47 01014_function_repeat_corner_cases: [ OK ] 0.48 sec. 2026-10-30 09:53:47 02136_kill_scalar_queries: [ OK ] 4.65 sec. 2026-10-30 09:53:47 01657_array_element_ubsan: [ OK ] 0.49 sec. 2026-10-30 09:53:47 01812_optimize_skip_unused_shards_single_node: [ OK ] 0.51 sec. 2026-10-30 09:53:48 02474_timeDiff_UTCTimestamp: [ OK ] 0.37 sec. 2026-10-30 09:53:48 02792_drop_projection_lwd: [ OK ] 0.59 sec. 2026-10-30 09:53:48 02428_parameterized_view: [ OK ] 37.83 sec. 2026-10-30 09:53:49 02184_ipv6_select_parsing: [ OK ] 0.59 sec. 2026-10-30 09:53:49 01013_totals_without_aggregation: [ OK ] 0.50 sec. 2026-10-30 09:53:49 01354_tuple_low_cardinality_array_mapped_bug: [ OK ] 0.48 sec. 2026-10-30 09:53:50 01586_columns_pruning: [ OK ] 0.63 sec. 2026-10-30 09:53:50 00195_shard_union_all_and_global_in: [ OK ] 0.53 sec. 2026-10-30 09:53:52 02489_analyzer_indexes: [ OK ] 0.99 sec. 2026-10-30 09:53:52 02969_archive_seek: [ OK ] 3.55 sec. 2026-10-30 09:53:53 00991_system_parts_race_condition_long: [ OK ] 33.81 sec. 2026-10-30 09:53:53 02149_schema_inference_create_table_syntax: [ OK ] 11.20 sec. 2026-10-30 09:53:53 00804_test_alter_compression_codecs: [ OK ] 8.85 sec. 2026-10-30 09:53:53 01031_pmj_new_any_semi_join: [ OK ] 0.87 sec. 2026-10-30 09:53:54 00287_column_const_with_nan: [ OK ] 0.32 sec. 2026-10-30 09:53:54 00607_index_in_in: [ OK ] 0.37 sec. 2026-10-30 09:53:54 00311_array_primary_key: [ OK ] 0.42 sec. 2026-10-30 09:53:54 02793_implicit_pretty_format_settings: [ OK ] 2.40 sec. 2026-10-30 09:53:54 00662_has_nullable: [ OK ] 0.37 sec. 2026-10-30 09:53:54 03002_modify_query_cte: [ OK ] 0.32 sec. 2026-10-30 09:53:54 00986_materialized_view_stack_overflow: [ OK ] 0.57 sec. 2026-10-30 09:53:54 02907_preferred_optimize_projection_name: [ OK ] 9.07 sec. 2026-10-30 09:53:55 02469_interval_msan: [ OK ] 0.47 sec. 2026-10-30 09:53:55 02967_analyzer_fuzz: [ OK ] 0.37 sec. 2026-10-30 09:53:55 02995_index_5: [ SKIPPED ] 0.00 sec. 2026-10-30 09:53:55 Reason: not running for current build 2026-10-30 09:53:55 03042_not_found_column_c1: [ OK ] 0.37 sec. 2026-10-30 09:53:55 00590_limit_by_column_removal: [ OK ] 0.32 sec. 2026-10-30 09:53:55 02886_missed_json_subcolumns: [ OK ] 0.42 sec. 2026-10-30 09:53:55 03035_dynamic_sorting: [ OK ] 0.47 sec. 2026-10-30 09:53:55 00271_agg_state_and_totals: [ OK ] 0.32 sec. 2026-10-30 09:53:55 00136_duplicate_order_by_elems: [ OK ] 0.37 sec. 2026-10-30 09:53:56 00725_join_on_bug_3: [ OK ] 0.32 sec. 2026-10-30 09:53:56 01703_rewrite_aggregate_function_case_insensitive: [ OK ] 0.32 sec. 2026-10-30 09:53:56 02012_compress_lz4: [ OK ] 2.43 sec. 2026-10-30 09:53:56 01081_demangle: [ OK ] 0.27 sec. 2026-10-30 09:53:56 03227_dynamic_subcolumns_enumerate_streams: [ OK ] 0.32 sec. 2026-10-30 09:53:56 02020_exponential_smoothing: [ OK ] 1.68 sec. 2026-10-30 09:53:56 02354_vector_search_queries: [ OK ] 0.42 sec. 2026-10-30 09:53:56 02160_special_functions: [ OK ] 0.42 sec. 2026-10-30 09:53:57 00608_uniq_array: [ OK ] 0.32 sec. 2026-10-30 09:53:57 01505_trivial_count_with_partition_predicate: [ OK ] 0.52 sec. 2026-10-30 09:53:57 03147_asof_join_ddb_missing: [ OK ] 0.82 sec. 2026-10-30 09:53:57 01710_projection_row_policy: [ OK ] 0.37 sec. 2026-10-30 09:53:57 02442_auxiliary_zookeeper_endpoint_id: [ OK ] 0.47 sec. 2026-10-30 09:53:57 02454_disable_mergetree_with_lightweight_delete_column: [ OK ] 0.42 sec. 2026-10-30 09:53:57 02910_nullable_enum_cast: [ OK ] 0.32 sec. 2026-10-30 09:53:57 00751_low_cardinality_nullable_group_by: [ OK ] 1.07 sec. 2026-10-30 09:53:58 03001_backup_matview_after_modify_query: [ OK ] 4.23 sec. 2026-10-30 09:53:58 01425_default_value_of_type_name: [ OK ] 0.32 sec. 2026-10-30 09:53:59 01521_max_length_alias: [ OK ] 0.32 sec. 2026-10-30 09:53:59 03023_remove_unused_column_distinct: [ OK ] 0.32 sec. 2026-10-30 09:53:59 02922_server_exit_code: [ OK ] 2.23 sec. 2026-10-30 09:53:59 02316_hierarchical_dictionaries_nullable_parent_key: [ OK ] 0.47 sec. 2026-10-30 09:54:00 01691_DateTime64_clamp: [ OK ] 0.32 sec. 2026-10-30 09:54:00 01650_expressions_merge_bug: [ OK ] 0.32 sec. 2026-10-30 09:54:00 01053_if_chain_check: [ OK ] 0.32 sec. 2026-10-30 09:54:01 00700_decimal_in_keys: [ OK ] 0.37 sec. 2026-10-30 09:54:01 00925_zookeeper_empty_replicated_merge_tree_optimize_final_long: [ OK ] 3.93 sec. 2026-10-30 09:54:02 02376_analyzer_in_function_subquery: [ OK ] 0.37 sec. 2026-10-30 09:54:02 02043_user_defined_executable_function_implicit_cast: [ OK ] 0.67 sec. 2026-10-30 09:54:03 03172_dynamic_binary_serialization: [ OK ] 20.21 sec. 2026-10-30 09:54:03 00612_http_max_query_size_for_distributed: [ OK ] 0.37 sec. 2026-10-30 09:54:03 02354_window_expression_with_aggregation_expression: [ OK ] 0.37 sec. 2026-10-30 09:54:03 01505_log_distributed_deadlock: [ OK ] 0.32 sec. 2026-10-30 09:54:03 01940_point_in_polygon_ubsan: [ OK ] 0.33 sec. 2026-10-30 09:54:04 02254_projection_broken_part: [ OK ] 6.34 sec. 2026-10-30 09:54:04 01428_hash_set_nan_key: [ OK ] 0.32 sec. 2026-10-30 09:54:04 02389_analyzer_nested_lambda: [ OK ] 3.58 sec. 2026-10-30 09:54:05 02962_join_using_bug_57894: [ OK ] 0.32 sec. 2026-10-30 09:54:05 02046_low_cardinality_parallel_group_by: [ OK ] 5.19 sec. 2026-10-30 09:54:05 01362_year_of_ISO8601_week_modificators_for_formatDateTime: [ OK ] 0.32 sec. 2026-10-30 09:54:05 03196_max_intersections_arena_crash: [ OK ] 0.32 sec. 2026-10-30 09:54:05 02810_row_binary_with_defaults: [ OK ] 0.27 sec. 2026-10-30 09:54:06 00825_protobuf_format_skipped_column_in_nested: [ OK ] 3.28 sec. 2026-10-30 09:54:07 00578_merge_table_sampling: [ OK ] 0.37 sec. 2026-10-30 09:54:07 01776_decrypt_aead_size_check: [ OK ] 0.27 sec. 2026-10-30 09:54:07 00169_join_constant_keys: [ OK ] 0.27 sec. 2026-10-30 09:54:07 01622_defaults_for_url_engine: [ OK ] 2.13 sec. 2026-10-30 09:54:08 01766_todatetime64_no_timezone_arg: [ OK ] 0.27 sec. 2026-10-30 09:54:08 02377_modify_column_from_lc: [ OK ] 0.52 sec. 2026-10-30 09:54:08 00315_quantile_off_by_one: [ OK ] 0.32 sec. 2026-10-30 09:54:08 01273_arrow: [ OK ] 20.31 sec. 2026-10-30 09:54:09 01691_parser_data_type_exponential: [ OK ] 4.33 sec. 2026-10-30 09:54:10 00161_rounding_functions: [ OK ] 0.52 sec. 2026-10-30 09:54:10 02844_table_function_url_filter_by_virtual_columns: [ OK ] 2.37 sec. 2026-10-30 09:54:10 02814_create_index_uniq_noop: [ OK ] 0.27 sec. 2026-10-30 09:54:10 02415_all_new_functions_must_be_documented: [ OK ] 0.32 sec. 2026-10-30 09:54:10 00943_mv_rename_without_inner_table: [ OK ] 0.32 sec. 2026-10-30 09:54:11 02533_generate_random_schema_inference: [ OK ] 0.27 sec. 2026-10-30 09:54:11 01038_array_of_unnamed_tuples: [ OK ] 0.32 sec. 2026-10-30 09:54:11 00726_length_aliases: [ OK ] 0.27 sec. 2026-10-30 09:54:11 03038_move_partition_to_oneself_deadlock: [ OK ] 0.32 sec. 2026-10-30 09:54:11 00551_parse_or_null: [ OK ] 0.27 sec. 2026-10-30 09:54:12 00836_indices_alter_replicated_zookeeper_long: [ OK ] 0.77 sec. 2026-10-30 09:54:12 00825_protobuf_format_persons: [ OK ] 8.04 sec. 2026-10-30 09:54:13 00913_many_threads: [ OK ] 1.02 sec. 2026-10-30 09:54:14 00552_logical_functions_uint8_as_bool: [ OK ] 0.32 sec. 2026-10-30 09:54:14 01601_proxy_protocol: [ OK ] 1.87 sec. 2026-10-30 09:54:14 00725_join_on_bug_2: [ OK ] 0.42 sec. 2026-10-30 09:54:14 03033_lightweight_deletes_sync: [ OK ] 0.37 sec. 2026-10-30 09:54:14 03284_json_object_as_tuple_duplicate_keys: [ OK ] 0.37 sec. 2026-10-30 09:54:15 01509_parallel_quorum_and_merge_long: [ OK ] 7.44 sec. 2026-10-30 09:54:15 02122_4letter_words_stress_zookeeper: [ OK ] 19.53 sec. 2026-10-30 09:54:16 01051_same_name_alias_with_joins: [ OK ] 0.32 sec. 2026-10-30 09:54:16 01585_fuzz_bits_with_bugfix: [ OK ] 0.32 sec. 2026-10-30 09:54:17 01155_old_mutation_parts_to_do: [ OK ] 13.37 sec. 2026-10-30 09:54:17 00667_compare_arrays_of_different_types: [ OK ] 0.32 sec. 2026-10-30 09:54:17 01720_country_perimeter_and_area: [ OK ] 5.93 sec. 2026-10-30 09:54:18 02494_analyzer_compound_expression_crash_fix: [ OK ] 0.32 sec. 2026-10-30 09:54:18 02183_dictionary_date_types: [ OK ] 0.52 sec. 2026-10-30 09:54:19 01783_parallel_formatting_memory: [ OK ] 1.92 sec. 2026-10-30 09:54:20 01165_lost_part_empty_partition: [ OK ] 3.48 sec. 2026-10-30 09:54:20 00621_regression_for_in_operator: [ OK ] 0.42 sec. 2026-10-30 09:54:20 02149_schema_inference_formats_with_schema_3: [ OK ] 5.69 sec. 2026-10-30 09:54:20 02240_get_type_serialization_streams: [ OK ] 0.37 sec. 2026-10-30 09:54:20 02571_local_desc_abort_on_twitter_json: [ OK ] 2.18 sec. 2026-10-30 09:54:20 03352_distinct_sorted_bug: [ OK ] 0.32 sec. 2026-10-30 09:54:20 00069_date_arithmetic: [ OK ] 0.37 sec. 2026-10-30 09:54:22 02293_ttest_large_samples: [ OK ] 1.37 sec. 2026-10-30 09:54:22 02306_rowbinary_has_no_bom: [ OK ] 1.92 sec. 2026-10-30 09:54:22 01374_if_nullable_filimonov: [ OK ] 0.32 sec. 2026-10-30 09:54:22 02475_or_function_alias_and_const_where: [ OK ] 0.32 sec. 2026-10-30 09:54:22 01603_read_with_backoff_bug: [ OK ] 8.00 sec. 2026-10-30 09:54:23 01445_create_table_as_table_function: [ OK ] 2.58 sec. 2026-10-30 09:54:23 03148_setting_max_streams_to_max_threads_ratio_overflow: [ OK ] 0.37 sec. 2026-10-30 09:54:23 00353_join_by_tuple: [ OK ] 0.27 sec. 2026-10-30 09:54:23 00633_materialized_view_and_too_many_parts_zookeeper: [ OK ] 7.64 sec. 2026-10-30 09:54:23 00681_duplicate_columns_inside_union_all_stas_sviridov: [ OK ] 0.32 sec. 2026-10-30 09:54:24 01596_setting_limit_offset: [ OK ] 0.37 sec. 2026-10-30 09:54:25 01854_HTTP_dict_decompression: [ OK ] 2.22 sec. 2026-10-30 09:54:25 01019_alter_materialized_view_atomic: [ OK ] 28.22 sec. 2026-10-30 09:54:25 02915_analyzer_fuzz_1: [ OK ] 0.27 sec. 2026-10-30 09:54:26 02845_parquet_odd_decimals: [ OK ] 2.93 sec. 2026-10-30 09:54:26 01528_setting_aggregate_functions_null_for_empty: [ OK ] 0.37 sec. 2026-10-30 09:54:26 02421_simple_queries_for_opentelemetry: [ OK ] 6.14 sec. 2026-10-30 09:54:27 00030_alter_table: [ OK ] 0.47 sec. 2026-10-30 09:54:27 01170_alter_partition_isolation: [ OK ] 5.13 sec. 2026-10-30 09:54:27 02902_add_scalar_in_all_case: [ OK ] 0.32 sec. 2026-10-30 09:54:28 01585_use_index_for_global_in: [ OK ] 0.37 sec. 2026-10-30 09:54:28 02800_clickhouse_local_default_settings: [ OK ] 2.02 sec. 2026-10-30 09:54:28 00578_merge_table_and_table_virtual_column: [ OK ] 0.42 sec. 2026-10-30 09:54:28 03084_analyzer_join_column_alias: [ OK ] 0.32 sec. 2026-10-30 09:54:28 00882_multiple_join_no_alias: [ OK ] 0.32 sec. 2026-10-30 09:54:28 02478_analyzer_table_expression_aliases: [ OK ] 0.42 sec. 2026-10-30 09:54:28 00752_low_cardinality_permute: [ OK ] 0.37 sec. 2026-10-30 09:54:28 01433_hex_float: [ OK ] 0.27 sec. 2026-10-30 09:54:28 02811_primary_key_in_columns: [ OK ] 0.47 sec. 2026-10-30 09:54:29 03116_analyzer_explicit_alias_as_column_name: [ OK ] 0.27 sec. 2026-10-30 09:54:29 01710_minmax_count_projection_constant_query: [ OK ] 0.32 sec. 2026-10-30 09:54:29 02699_polygons_sym_difference_rollup: [ OK ] 0.27 sec. 2026-10-30 09:54:29 00073_merge_sorting_empty_array_joined: [ OK ] 0.27 sec. 2026-10-30 09:54:29 01084_regexp_empty: [ OK ] 0.27 sec. 2026-10-30 09:54:29 02499_escaped_quote_schema_inference: [ OK ] 0.27 sec. 2026-10-30 09:54:30 02383_arrow_dict_special_cases: [ OK ] 4.28 sec. 2026-10-30 09:54:30 00688_low_cardinality_syntax: [ OK ] 0.42 sec. 2026-10-30 09:54:30 02841_not_ready_set_bug: [ OK ] 3.98 sec. 2026-10-30 09:54:30 02455_duplicate_column_names_in_schema_inference: [ OK ] 0.32 sec. 2026-10-30 09:54:30 00826_cross_to_inner_join: [ OK ] 0.57 sec. 2026-10-30 09:54:31 02009_body_query_params: [ OK ] 1.87 sec. 2026-10-30 09:54:31 02985_minmax_index_aggregate_function: [ OK ] 0.37 sec. 2026-10-30 09:54:31 02725_cnf_large_check: [ OK ] 0.42 sec. 2026-10-30 09:54:31 03171_hashed_dictionary_short_circuit_bug_fix: [ OK ] 0.36 sec. 2026-10-30 09:54:32 02345_filesystem_local: [ OK ] 2.08 sec. 2026-10-30 09:54:32 02124_insert_deduplication_token_replica: [ OK ] 0.47 sec. 2026-10-30 09:54:32 01107_tuples_arrays_parsing_exceptions: [ OK ] 2.32 sec. 2026-10-30 09:54:34 02994_merge_tree_mutations_cleanup: [ OK ] 10.40 sec. 2026-10-30 09:54:34 00284_external_aggregation_2: [ OK ] 3.63 sec. 2026-10-30 09:54:34 01083_match_zero_byte: [ OK ] 0.32 sec. 2026-10-30 09:54:35 02832_transform_fixed_string_no_default: [ OK ] 0.32 sec. 2026-10-30 09:54:35 02015_async_inserts_4: [ OK ] 5.79 sec. 2026-10-30 09:54:35 00823_capnproto_input: [ SKIPPED ] 0.00 sec. 2026-10-30 09:54:35 Reason: not running for current build 2026-10-30 09:54:35 02267_join_dup_columns_issue36199: [ OK ] 0.42 sec. 2026-10-30 09:54:35 03085_analyzer_alias_column_group_by: [ OK ] 0.27 sec. 2026-10-30 09:54:35 01024__getScalar: [ OK ] 0.32 sec. 2026-10-30 09:54:35 00164_not_chain: [ OK ] 0.27 sec. 2026-10-30 09:54:35 02000_table_function_cluster_macros: [ OK ] 0.32 sec. 2026-10-30 09:54:35 01795_TinyLog_rwlock_ub: [ OK ] 0.32 sec. 2026-10-30 09:54:36 02833_std_alias: [ OK ] 0.32 sec. 2026-10-30 09:54:36 02475_analyzer_join_tree_subquery: [ OK ] 0.27 sec. 2026-10-30 09:54:36 00521_multidimensional: [ OK ] 0.42 sec. 2026-10-30 09:54:36 01825_type_json_schema_inference: [ OK ] 4.28 sec. 2026-10-30 09:54:36 02424_pod_array_overflow: [ OK ] 0.27 sec. 2026-10-30 09:54:37 00717_merge_and_distributed: [ OK ] 0.87 sec. 2026-10-30 09:54:37 03032_numbers_zeros: [ OK ] 0.37 sec. 2026-10-30 09:54:37 02515_tuple_lambda_parsing: [ OK ] 0.27 sec. 2026-10-30 09:54:38 00196_float32_formatting: [ OK ] 0.32 sec. 2026-10-30 09:54:38 01234_to_string_monotonic: [ OK ] 0.47 sec. 2026-10-30 09:54:38 01675_distributed_bytes_to_delay_insert: [ OK ] 6.28 sec. 2026-10-30 09:54:38 02556_local_with_totals_and_extremes: [ OK ] 2.12 sec. 2026-10-30 09:54:38 01825_type_json_1: [ OK ] 0.37 sec. 2026-10-30 09:54:38 02771_if_constant_folding: [ OK ] 0.27 sec. 2026-10-30 09:54:39 02500_bson_read_object_id: [ OK ] 2.27 sec. 2026-10-30 09:54:39 01683_intdiv_ubsan: [ OK ] 0.37 sec. 2026-10-30 09:54:39 01017_bithamming_distance: [ OK ] 0.32 sec. 2026-10-30 09:54:39 02922_respect_nulls_parser: [ OK ] 0.52 sec. 2026-10-30 09:54:39 01683_dist_INSERT_block_structure_mismatch: [ OK ] 0.32 sec. 2026-10-30 09:54:39 01549_low_cardinality_mv_fuzz: [ OK ] 0.32 sec. 2026-10-30 09:54:39 01147_partial_merge_full_join: [ OK ] 0.77 sec. 2026-10-30 09:54:40 02559_add_parts: [ OK ] 0.37 sec. 2026-10-30 09:54:40 00844_join_lightee2: [ OK ] 0.32 sec. 2026-10-30 09:54:40 02896_max_execution_time_with_break_overflow_mode: [ OK ] 5.28 sec. 2026-10-30 09:54:41 00368_format_option_collision: [ OK ] 2.17 sec. 2026-10-30 09:54:41 02813_series_period_detect: [ OK ] 0.42 sec. 2026-10-30 09:54:41 03143_parallel_replicas_mat_view_bug: [ OK ] 0.32 sec. 2026-10-30 09:54:42 03214_count_distinct_null_key_memory_leak: [ OK ] 2.18 sec. 2026-10-30 09:54:42 01456_modify_column_type_via_add_drop_update: [ OK ] 0.62 sec. 2026-10-30 09:54:42 01514_empty_buffer_different_types: [ OK ] 0.37 sec. 2026-10-30 09:54:42 00400_client_external_options: [ OK ] 3.08 sec. 2026-10-30 09:54:43 03208_buffer_over_distributed_type_mismatch: [ OK ] 0.62 sec. 2026-10-30 09:54:43 00340_squashing_insert_select: [ OK ] 1.27 sec. 2026-10-30 09:54:43 02045_like_function: [ OK ] 0.27 sec. 2026-10-30 09:54:44 02125_constant_if_condition_and_not_existing_column: [ OK ] 0.37 sec. 2026-10-30 09:54:44 02661_read_from_archive_tzst: [ OK ] 11.50 sec. 2026-10-30 09:54:44 00409_shard_limit_by: [ OK ] 0.47 sec. 2026-10-30 09:54:44 03131_deprecated_functions: [ OK ] 0.42 sec. 2026-10-30 09:54:45 01359_geodistance_loop: [ OK ] 0.27 sec. 2026-10-30 09:54:45 03221_merge_profile_events: [ OK ] 0.87 sec. 2026-10-30 09:54:45 01440_big_int_shift: [ OK ] 0.27 sec. 2026-10-30 09:54:45 02224_parallel_distributed_insert_select_cluster: [ OK ] 0.42 sec. 2026-10-30 09:54:45 01825_new_type_json_18: [ OK ] 0.32 sec. 2026-10-30 09:54:46 02021_exponential_sum_shard: [ OK ] 0.77 sec. 2026-10-30 09:54:46 02706_kolmogorov_smirnov_test: [ OK ] 0.42 sec. 2026-10-30 09:54:47 02423_insert_stats_behaviour: [ OK ] 5.54 sec. 2026-10-30 09:54:47 02973_parse_crlf_with_tsv_files: [ OK ] 2.63 sec. 2026-10-30 09:54:47 01293_pretty_max_value_width: [ OK ] 0.37 sec. 2026-10-30 09:54:47 01825_new_type_json_3: [ OK ] 0.62 sec. 2026-10-30 09:54:47 02518_delete_on_materialized_view: [ OK ] 0.32 sec. 2026-10-30 09:54:48 02553_new_type_json_attach_partition: [ OK ] 0.32 sec. 2026-10-30 09:54:48 01093_cyclic_defaults_filimonov: [ OK ] 0.32 sec. 2026-10-30 09:54:48 03240_insert_select_named_tuple: [ OK ] 0.37 sec. 2026-10-30 09:54:49 03198_bit_shift_throws_error_for_out_of_bounds: [ OK ] 0.52 sec. 2026-10-30 09:54:49 00700_decimal_complex_types: [ OK ] 1.17 sec. 2026-10-30 09:54:49 02543_alter_update_rename_stuck: [ OK ] 7.14 sec. 2026-10-30 09:54:49 00808_not_optimize_predicate: [ OK ] 0.42 sec. 2026-10-30 09:54:49 02160_client_autocomplete_parse_query: [ OK ] 3.23 sec. 2026-10-30 09:54:49 01346_alter_enum_partition_key_replicated_zookeeper_long: [ OK ] 0.82 sec. 2026-10-30 09:54:50 02949_parallel_replicas_scalar_subquery_big_integer: [ OK ] 0.32 sec. 2026-10-30 09:54:50 02922_respect_nulls_extensive: [ OK ] 0.57 sec. 2026-10-30 09:54:50 01659_test_base64Decode_mysql_compatibility: [ OK ] 0.32 sec. 2026-10-30 09:54:50 02344_analyzer_multiple_aliases_for_expression: [ OK ] 0.42 sec. 2026-10-30 09:54:51 01685_json_extract_double_as_float: [ OK ] 0.32 sec. 2026-10-30 09:54:52 01945_system_warnings: [ OK ] 3.08 sec. 2026-10-30 09:54:52 02136_scalar_read_rows_json: [ OK ] 2.33 sec. 2026-10-30 09:54:53 01097_cyclic_defaults: [ OK ] 0.47 sec. 2026-10-30 09:54:53 02312_parquet_orc_arrow_names_tuples: [ OK ] 0.42 sec. 2026-10-30 09:54:53 02474_fix_function_parser_bug: [ OK ] 0.27 sec. 2026-10-30 09:54:53 01891_not_like_partition_prune: [ OK ] 0.32 sec. 2026-10-30 09:54:53 01811_storage_buffer_flush_parameters: [ OK ] 4.13 sec. 2026-10-30 09:54:56 03006_async_insert_deadlock_log: [ OK ] 2.83 sec. 2026-10-30 09:54:58 01273_arrow_dictionaries_load: [ OK ] 7.19 sec. 2026-10-30 09:54:58 02941_variant_type_2: [ OK ] 12.40 sec. 2026-10-30 09:54:58 01846_alter_column_without_type_bugfix: [ OK ] 0.32 sec. 2026-10-30 09:54:58 00906_low_cardinality_rollup: [ OK ] 0.32 sec. 2026-10-30 09:54:59 02864_replace_regexp_string_fallback: [ OK ] 0.37 sec. 2026-10-30 09:54:59 01377_supertype_low_cardinality: [ OK ] 0.57 sec. 2026-10-30 09:55:00 00738_lock_for_inner_table: [ OK ] 3.63 sec. 2026-10-30 09:55:00 02790_client_max_opening_fd: [ OK ] 2.07 sec. 2026-10-30 09:55:00 00897_flatten: [ OK ] 0.32 sec. 2026-10-30 09:55:01 00545_weird_aggregate_functions: [ OK ] 0.27 sec. 2026-10-30 09:55:01 02346_fulltext_index_search: [ OK ] 1.32 sec. 2026-10-30 09:55:01 02158_ztest: [ OK ] 0.32 sec. 2026-10-30 09:55:02 01283_strict_resize_bug: [ OK ] 0.97 sec. 2026-10-30 09:55:03 00688_low_cardinality_serialization: [ OK ] 2.43 sec. 2026-10-30 09:55:03 02884_parquet_new_encodings: [ OK ] 1.97 sec. 2026-10-30 09:55:03 02535_analyzer_limit_offset: [ OK ] 0.27 sec. 2026-10-30 09:55:06 02421_type_json_async_insert: [ OK ] 4.03 sec. 2026-10-30 09:55:07 00800_versatile_storage_join: [ OK ] 0.52 sec. 2026-10-30 09:55:07 00534_exp10: [ OK ] 0.27 sec. 2026-10-30 09:55:07 02477_age: [ OK ] 0.47 sec. 2026-10-30 09:55:08 02550_client_connections_credentials: [ OK ] 14.31 sec. 2026-10-30 09:55:08 01079_new_range_reader_segfault: [ OK ] 0.32 sec. 2026-10-30 09:55:08 02517_infer_uint64_in_case_of_int64_overflow: [ OK ] 4.93 sec. 2026-10-30 09:55:08 00440_nulls_merge_tree: [ OK ] 0.32 sec. 2026-10-30 09:55:08 00258_materializing_tuples: [ OK ] 0.27 sec. 2026-10-30 09:55:09 00908_bloom_filter_index: [ OK ] 15.91 sec. 2026-10-30 09:55:09 01458_is_decimal_overflow: [ OK ] 0.42 sec. 2026-10-30 09:55:09 02842_largestTriangleThreeBuckets_aggregate_function: [ OK ] 0.42 sec. 2026-10-30 09:55:09 00626_replace_partition_from_table_zookeeper: [ OK ] 29.30 sec. 2026-10-30 09:55:09 03014_analyzer_groupby_fuzz_60317: [ OK ] 0.32 sec. 2026-10-30 09:55:10 00265_http_content_type_format_timezone: [ OK ] 2.33 sec. 2026-10-30 09:55:10 03036_test_parquet_bloom_filter_push_down: [ SKIPPED ] 0.00 sec. 2026-10-30 09:55:10 Reason: not running for current build 2026-10-30 09:55:11 01921_datatype_date32: [ OK ] 1.02 sec. 2026-10-30 09:55:11 03274_format_inference_create_query_file: [ OK ] 2.33 sec. 2026-10-30 09:55:12 02597_column_delete_and_replication: [ OK ] 1.37 sec. 2026-10-30 09:55:12 01913_fix_column_transformer_replace_format: [ OK ] 0.32 sec. 2026-10-30 09:55:12 02129_skip_quoted_fields: [ OK ] 9.60 sec. 2026-10-30 09:55:12 01651_lc_insert_tiny_log_1: [ OK ] 4.38 sec. 2026-10-30 09:55:13 00449_filter_array_nullable_tuple: [ OK ] 0.32 sec. 2026-10-30 09:55:13 02335_column_ttl_expired_column_optimization: [ OK ] 2.28 sec. 2026-10-30 09:55:13 03033_cte_numbers_memory: [ OK ] 0.32 sec. 2026-10-30 09:55:13 02769_compare_functions_nan: [ OK ] 0.42 sec. 2026-10-30 09:55:14 00520_http_nullable: [ OK ] 1.97 sec. 2026-10-30 09:55:14 01600_multiple_left_join_with_aliases: [ OK ] 0.32 sec. 2026-10-30 09:55:14 01115_prewhere_array_join: [ OK ] 0.72 sec. 2026-10-30 09:55:14 00556_array_intersect: [ OK ] 0.32 sec. 2026-10-30 09:55:14 02003_WithMergeableStateAfterAggregationAndLimit_LIMIT_BY_LIMIT_OFFSET: [ OK ] 0.37 sec. 2026-10-30 09:55:14 02566_analyzer_limit_settings_distributed: [ OK ] 0.37 sec. 2026-10-30 09:55:14 00564_initial_column_values_with_default_expression: [ OK ] 0.37 sec. 2026-10-30 09:55:15 00609_prewhere_and_default: [ OK ] 0.47 sec. 2026-10-30 09:55:15 01583_parallel_parsing_exception_with_offset: [ OK ] 3.23 sec. 2026-10-30 09:55:15 00952_insert_into_distributed_with_materialized_column: [ OK ] 0.57 sec. 2026-10-30 09:55:15 03048_not_found_column_xxx_in_block: [ OK ] 0.32 sec. 2026-10-30 09:55:16 02247_read_bools_as_numbers_json: [ OK ] 6.94 sec. 2026-10-30 09:55:16 01045_bloom_filter_null_array: [ OK ] 0.37 sec. 2026-10-30 09:55:16 03020_output_format_client: [ OK ] 3.78 sec. 2026-10-30 09:55:16 02337_join_analyze_stuck: [ OK ] 0.42 sec. 2026-10-30 09:55:17 01119_optimize_trivial_insert_select: [ OK ] 0.52 sec. 2026-10-30 09:55:17 02361_fsync_profile_events: [ OK ] 3.13 sec. 2026-10-30 09:55:17 01663_quantile_weighted_overflow: [ OK ] 0.32 sec. 2026-10-30 09:55:17 03251_unaligned_window_function_state: [ OK ] 0.32 sec. 2026-10-30 09:55:18 00700_to_decimal_or_something_1: [ OK ] 0.87 sec. 2026-10-30 09:55:19 00662_array_has_nullable: [ OK ] 0.42 sec. 2026-10-30 09:55:19 02122_parallel_formatting_JSONCompactEachRowWithNamesAndTypes: [ OK ] 3.48 sec. 2026-10-30 09:55:19 03215_grant_current_grants: [ OK ] 3.98 sec. 2026-10-30 09:55:19 02903_bug_43644: [ OK ] 0.32 sec. 2026-10-30 09:55:19 03274_dynamic_column_data_race_with_concurrent_hj: [ OK ] 0.32 sec. 2026-10-30 09:55:19 02042_map_get_non_const_key: [ OK ] 0.27 sec. 2026-10-30 09:55:19 01702_rewrite_avg_for_algebraic_optimization: [ OK ] 0.37 sec. 2026-10-30 09:55:20 01308_orc_output_format_arrays: [ OK ] 3.03 sec. 2026-10-30 09:55:20 02302_projections_GROUP_BY_ORDERY_BY_optimize_aggregation_in_order: [ OK ] 0.32 sec. 2026-10-30 09:55:20 01825_type_json_partitions: [ OK ] 0.33 sec. 2026-10-30 09:55:20 02798_explain_settings_not_applied_bug: [ OK ] 0.32 sec. 2026-10-30 09:55:20 02370_analyzer_in_function: [ OK ] 0.37 sec. 2026-10-30 09:55:20 02981_vertical_merges_memory_usage: [ OK ] 1.22 sec. 2026-10-30 09:55:20 02841_not_ready_set_constraints: [ OK ] 0.38 sec. 2026-10-30 09:55:21 02554_invalid_create_view_syntax: [ OK ] 0.27 sec. 2026-10-30 09:55:21 02971_limit_by_distributed: [ OK ] 0.32 sec. 2026-10-30 09:55:21 02955_analyzer_using_functional_args: [ OK ] 0.77 sec. 2026-10-30 09:55:23 02125_lz4_compression_bug_TSKV: [ OK ] 6.59 sec. 2026-10-30 09:55:24 02784_parallel_replicas_automatic_decision: [ OK ] 8.69 sec. 2026-10-30 09:55:24 02488_zero_copy_detached_parts_drop_table: [ OK ] 4.93 sec. 2026-10-30 09:55:24 00673_subquery_prepared_set_performance: [ OK ] 0.47 sec. 2026-10-30 09:55:24 03142_alter_comment_parameterized_view: [ OK ] 0.27 sec. 2026-10-30 09:55:25 02398_subquery_where_pushdown_and_limit_offset: [ OK ] 0.32 sec. 2026-10-30 09:55:25 01710_aggregate_projection_with_monotonic_key_expr: [ OK ] 0.37 sec. 2026-10-30 09:55:25 02869_unicode_minus: [ OK ] 0.27 sec. 2026-10-30 09:55:25 02020_cast_integer_overflow: [ OK ] 0.27 sec. 2026-10-30 09:55:25 02110_clickhouse_local_custom_tld: [ OK ] 2.02 sec. 2026-10-30 09:55:25 02021_create_database_with_comment: [ OK ] 4.64 sec. 2026-10-30 09:55:25 03031_filter_float64_logical_error: [ OK ] 0.32 sec. 2026-10-30 09:55:25 00127_group_by_concat: [ OK ] 0.27 sec. 2026-10-30 09:55:26 02291_dictionary_scalar_subquery_reload: [ OK ] 0.37 sec. 2026-10-30 09:55:26 03199_has_lc_fixed_string: [ OK ] 0.32 sec. 2026-10-30 09:55:26 02584_compressor_codecs: [ OK ] 5.03 sec. 2026-10-30 09:55:26 03173_distinct_combinator_alignment: [ OK ] 0.32 sec. 2026-10-30 09:55:26 00712_nan_comparison: [ OK ] 0.37 sec. 2026-10-30 09:55:26 01475_read_subcolumns_2: [ OK ] 0.42 sec. 2026-10-30 09:55:26 00978_ml_math: [ OK ] 0.27 sec. 2026-10-30 09:55:27 01463_resample_overflow: [ OK ] 0.27 sec. 2026-10-30 09:55:27 01480_binary_operator_monotonicity: [ OK ] 0.47 sec. 2026-10-30 09:55:28 02476_fix_cast_parser_bug: [ OK ] 0.27 sec. 2026-10-30 09:55:28 02131_skip_index_not_materialized: [ OK ] 0.32 sec. 2026-10-30 09:55:28 01081_window_view_target_table_engine: [ OK ] 3.18 sec. 2026-10-30 09:55:28 03014_group_by_use_nulls_injective_functions_and_analyzer: [ OK ] 0.32 sec. 2026-10-30 09:55:28 02982_unambiguous_alter_commands: [ OK ] 0.27 sec. 2026-10-30 09:55:29 03013_repeat_with_nonnative_integers: [ OK ] 0.32 sec. 2026-10-30 09:55:29 02595_orc_arrow_parquet_more_types: [ OK ] 3.33 sec. 2026-10-30 09:55:29 01825_type_json_15: [ OK ] 3.53 sec. 2026-10-30 09:55:29 00028_shard_big_agg_aj_distributed: [ OK ] 0.37 sec. 2026-10-30 09:55:30 03001_block_offset_column_2: [ OK ] 0.37 sec. 2026-10-30 09:55:30 02122_parallel_formatting_Vertical: [ OK ] 3.88 sec. 2026-10-30 09:55:30 02394_every_profile_event_must_have_documentation: [ OK ] 0.32 sec. 2026-10-30 09:55:30 02204_fractional_progress_bar_long: [ SKIPPED ] 0.00 sec. 2026-10-30 09:55:30 Reason: not running for current build 2026-10-30 09:55:30 02812_subquery_operators: [ OK ] 0.32 sec. 2026-10-30 09:55:30 01121_remote_scalar_subquery: [ OK ] 0.32 sec. 2026-10-30 09:55:31 02918_optimize_count_for_merge_tables: [ OK ] 0.37 sec. 2026-10-30 09:55:31 00974_low_cardinality_cast: [ OK ] 0.32 sec. 2026-10-30 09:55:31 00973_uniq_non_associativity: [ OK ] 1.47 sec. 2026-10-30 09:55:31 02956_fix_to_start_of_milli_microsecond: [ OK ] 0.32 sec. 2026-10-30 09:55:31 00612_union_query_with_subquery: [ OK ] 0.27 sec. 2026-10-30 09:55:32 00841_temporary_table_database: [ OK ] 0.32 sec. 2026-10-30 09:55:32 00088_distinct_of_arrays_of_strings: [ OK ] 0.27 sec. 2026-10-30 09:55:32 01031_mutations_interpreter_and_context: [ OK ] 3.53 sec. 2026-10-30 09:55:33 01436_storage_merge_with_join_push_down: [ OK ] 0.37 sec. 2026-10-30 09:55:34 02167_format_from_file_extension: [ OK ] 12.50 sec. 2026-10-30 09:55:34 00900_orc_arrays_load: [ OK ] 3.58 sec. 2026-10-30 09:55:34 02316_cast_to_ip_address_default_column: [ OK ] 0.37 sec. 2026-10-30 09:55:35 01700_mod_negative_type_promotion: [ OK ] 0.32 sec. 2026-10-30 09:55:35 00700_decimal_formats: [ OK ] 0.32 sec. 2026-10-30 09:55:35 01089_alter_settings_old_format: [ OK ] 0.32 sec. 2026-10-30 09:55:35 02184_storage_add_support_ttl: [ OK ] 0.37 sec. 2026-10-30 09:55:35 02713_sequence_match_serialization_fix: [ OK ] 0.32 sec. 2026-10-30 09:55:35 02122_parallel_formatting_JSONCompactEachRowWithNames: [ OK ] 3.58 sec. 2026-10-30 09:55:35 03303_alias_inverse_order: [ OK ] 0.32 sec. 2026-10-30 09:55:36 02904_empty_order_by_with_setting_enabled: [ OK ] 2.78 sec. 2026-10-30 09:55:36 02961_analyzer_low_cardinality_fuzzer: [ OK ] 0.32 sec. 2026-10-30 09:55:36 02026_arrayDifference_const: [ OK ] 0.27 sec. 2026-10-30 09:55:36 01009_insert_select_data_loss: [ OK ] 0.32 sec. 2026-10-30 09:55:36 01318_map_populate_series: [ OK ] 0.42 sec. 2026-10-30 09:55:36 01472_toBoundsOfInterval_disallow_empty_tz_field: [ OK ] 0.67 sec. 2026-10-30 09:55:36 01328_bad_peephole_optimization: [ OK ] 0.27 sec. 2026-10-30 09:55:37 02724_function_in_left_table_clause_asof_join: [ OK ] 0.32 sec. 2026-10-30 09:55:37 02973_block_number_sparse_serialization_and_mutation: [ OK ] 0.52 sec. 2026-10-30 09:55:37 02568_json_array_length: [ OK ] 0.37 sec. 2026-10-30 09:55:37 00411_long_accurate_number_comparison_int2: [ OK ] 6.59 sec. 2026-10-30 09:55:37 03217_fliter_pushdown_no_keys: [ OK ] 0.32 sec. 2026-10-30 09:55:37 00213_multiple_global_in: [ OK ] 0.27 sec. 2026-10-30 09:55:38 01274_generate_random_nested: [ OK ] 1.82 sec. 2026-10-30 09:55:38 00517_date_parsing: [ OK ] 0.52 sec. 2026-10-30 09:55:38 02481_async_insert_dedup_token: [ OK ] 89.51 sec. 2026-10-30 09:55:38 00298_enum_width_and_cast: [ OK ] 0.37 sec. 2026-10-30 09:55:38 01622_constraints_simple_optimization: [ OK ] 0.88 sec. 2026-10-30 09:55:38 01780_column_sparse_tuple: [ OK ] 0.37 sec. 2026-10-30 09:55:38 02725_alias_columns_should_not_allow_compression_codec: [ OK ] 0.32 sec. 2026-10-30 09:55:38 01071_force_optimize_skip_unused_shards: [ OK ] 0.47 sec. 2026-10-30 09:55:38 02923_join_use_nulls_modulo: [ OK ] 0.27 sec. 2026-10-30 09:55:39 01250_fixed_string_comparison: [ OK ] 0.27 sec. 2026-10-30 09:55:39 01386_negative_float_constant_key_condition: [ OK ] 0.37 sec. 2026-10-30 09:55:39 00825_protobuf_format_array_3dim: [ OK ] 3.03 sec. 2026-10-30 09:55:39 01580_column_const_comparision: [ OK ] 0.27 sec. 2026-10-30 09:55:39 02311_hashed_array_dictionary_hierarchical_functions: [ OK ] 0.37 sec. 2026-10-30 09:55:39 01661_week_functions_string_args: [ OK ] 0.52 sec. 2026-10-30 09:55:39 00676_group_by_in: [ OK ] 0.32 sec. 2026-10-30 09:55:39 02458_empty_hdfs_url: [ OK ] 0.27 sec. 2026-10-30 09:55:39 00846_join_using_tuple_crash: [ OK ] 0.27 sec. 2026-10-30 09:55:39 02907_fromDaysSinceYearZero: [ OK ] 0.52 sec. 2026-10-30 09:55:42 00974_primary_key_for_lowCardinality: [ OK ] 4.34 sec. 2026-10-30 09:55:42 02971_analyzer_remote_id: [ OK ] 2.38 sec. 2026-10-30 09:55:42 01276_system_licenses: [ OK ] 0.32 sec. 2026-10-30 09:55:42 02402_merge_engine_with_view: [ OK ] 0.32 sec. 2026-10-30 09:55:42 01651_lc_insert_tiny_log_2: [ OK ] 3.43 sec. 2026-10-30 09:55:42 02968_analyzer_join_column_not_found: [ OK ] 0.32 sec. 2026-10-30 09:55:43 02815_fix_not_found_constants_col_in_block: [ OK ] 0.32 sec. 2026-10-30 09:55:43 02813_float_parsing: [ OK ] 0.27 sec. 2026-10-30 09:55:43 02842_mutations_replace_non_deterministic: [ OK ] 0.82 sec. 2026-10-30 09:55:43 01413_truncate_without_table_keyword: [ OK ] 0.32 sec. 2026-10-30 09:55:45 01532_clickhouse_local_tmp_folder: [ OK ] 2.02 sec. 2026-10-30 09:55:45 02301_harmful_reexec: [ OK ] 2.48 sec. 2026-10-30 09:55:45 02707_analyzer_nested_lambdas_types: [ OK ] 0.32 sec. 2026-10-30 09:55:45 01271_show_privileges: [ OK ] 0.27 sec. 2026-10-30 09:55:46 02454_compressed_marks_in_compact_part: [ OK ] 0.27 sec. 2026-10-30 09:55:46 01802_formatDateTime_DateTime64_century: [ OK ] 0.32 sec. 2026-10-30 09:55:46 02932_group_by_null_fuzzer: [ OK ] 0.27 sec. 2026-10-30 09:55:46 05316_row_policy_alias_column_distributed: [ OK ] 0.47 sec. 2026-10-30 09:55:46 00432_aggregate_function_scalars_and_constants: [ OK ] 0.42 sec. 2026-10-30 09:55:47 01710_normal_projection_join_plan_fix: [ OK ] 0.32 sec. 2026-10-30 09:55:47 02560_analyzer_materialized_view: [ OK ] 0.32 sec. 2026-10-30 09:55:47 00580_consistent_hashing_functions: [ OK ] 0.32 sec. 2026-10-30 09:55:48 02834_array_exists_segfault: [ OK ] 0.27 sec. 2026-10-30 09:55:48 02962_analyzer_constant_set: [ OK ] 0.27 sec. 2026-10-30 09:55:48 01891_partition_hash_no_long_int: [ OK ] 0.32 sec. 2026-10-30 09:55:48 03305_fix_kafka_table_with_kw_arguments: [ OK ] 0.27 sec. 2026-10-30 09:55:49 02811_parallel_replicas_prewhere_count: [ OK ] 0.37 sec. 2026-10-30 09:55:49 00800_function_java_hash: [ OK ] 0.32 sec. 2026-10-30 09:55:49 02521_incorrect_dealy_for_insert_bug_44902: [ OK ] 9.85 sec. 2026-10-30 09:55:49 00802_daylight_saving_time_shift_backwards_at_midnight: [ OK ] 0.27 sec. 2026-10-30 09:55:50 02097_polygon_dictionary_store_key: [ OK ] 0.37 sec. 2026-10-30 09:55:50 03034_ddls_and_merges_with_unusual_maps: [ OK ] 0.42 sec. 2026-10-30 09:55:50 00975_json_hang: [ OK ] 0.57 sec. 2026-10-30 09:55:50 00392_enum_nested_alter: [ OK ] 0.57 sec. 2026-10-30 09:55:51 00628_in_lambda_on_merge_table_bug: [ OK ] 0.32 sec. 2026-10-30 09:55:52 00746_sql_fuzzy: [ OK ] 89.43 sec. 2026-10-30 09:55:52 02368_analyzer_table_functions: [ OK ] 0.32 sec. 2026-10-30 09:55:54 01156_pcg_deserialization: [ OK ] 10.86 sec. 2026-10-30 09:55:54 02122_join_group_by_timeout: [ OK ] 7.35 sec. 2026-10-30 09:55:54 00310_tskv: [ OK ] 3.13 sec. 2026-10-30 09:55:54 01550_mutation_subquery: [ OK ] 0.32 sec. 2026-10-30 09:55:54 00700_decimal_defaults: [ OK ] 0.27 sec. 2026-10-30 09:55:54 02122_parallel_formatting_TSVWithNames: [ OK ] 3.43 sec. 2026-10-30 09:55:54 02785_global_join_too_many_columns: [ OK ] 0.37 sec. 2026-10-30 09:55:54 03046_column_in_block_array_join: [ OK ] 0.32 sec. 2026-10-30 09:55:54 02149_schema_inference: [ OK ] 14.91 sec. 2026-10-30 09:55:54 00447_foreach_modifier: [ OK ] 0.37 sec. 2026-10-30 09:55:54 03031_tuple_elimination_analyzer: [ OK ] 0.32 sec. 2026-10-30 09:55:55 00054_join_string: [ OK ] 0.27 sec. 2026-10-30 09:55:55 02897_alter_partition_parameters: [ OK ] 0.57 sec. 2026-10-30 09:55:55 02574_suspicious_low_cardinality_msan: [ OK ] 0.37 sec. 2026-10-30 09:55:55 03157_dynamic_type_json: [ OK ] 0.37 sec. 2026-10-30 09:55:55 02364_dictionary_datetime_64_attribute_crash: [ OK ] 0.32 sec. 2026-10-30 09:55:55 01882_total_rows_approx: [ OK ] 2.78 sec. 2026-10-30 09:55:55 02245_make_datetime64: [ OK ] 0.62 sec. 2026-10-30 09:55:55 00585_union_all_subquery_aggregation_column_removal: [ OK ] 0.32 sec. 2026-10-30 09:55:55 03222_datetime64_small_value_const: [ OK ] 0.47 sec. 2026-10-30 09:55:55 01640_distributed_async_insert_compression: [ OK ] 0.32 sec. 2026-10-30 09:55:55 02887_format_readable_timedelta_subseconds: [ OK ] 0.32 sec. 2026-10-30 09:55:55 01102_distributed_local_in_bug: [ OK ] 0.32 sec. 2026-10-30 09:55:55 02422_insert_different_granularity: [ OK ] 0.47 sec. 2026-10-30 09:55:56 02922_respect_nulls_Nullable: [ OK ] 0.42 sec. 2026-10-30 09:55:56 02185_arraySlice_negative_offset_size: [ OK ] 0.37 sec. 2026-10-30 09:55:56 01392_column_resolve: [ OK ] 0.32 sec. 2026-10-30 09:55:56 01930_optimize_skip_unused_shards_rewrite_in: [ OK ] 0.67 sec. 2026-10-30 09:55:56 02539_generate_random_ip: [ OK ] 0.32 sec. 2026-10-30 09:55:56 02998_projection_after_attach_partition: [ OK ] 0.37 sec. 2026-10-30 09:55:56 02151_hash_table_sizes_stats_distributed: [ SKIPPED ] 0.00 sec. 2026-10-30 09:55:56 Reason: not running for current build 2026-10-30 09:55:57 01095_tpch_like_smoke: [ OK ] 0.77 sec. 2026-10-30 09:55:57 02834_formats_with_variable_number_of_columns: [ OK ] 0.37 sec. 2026-10-30 09:55:57 02520_group_array_last: [ OK ] 0.52 sec. 2026-10-30 09:55:58 03008_deduplication_insert_into_partitioned_table: [ OK ] 0.87 sec. 2026-10-30 09:55:58 01785_parallel_formatting_memory: [ OK ] 2.43 sec. 2026-10-30 09:55:58 02562_with_fill_nullable: [ OK ] 0.32 sec. 2026-10-30 09:55:58 00102_insert_into_temporary_table: [ OK ] 0.27 sec. 2026-10-30 09:55:59 01780_column_sparse_distinct: [ OK ] 0.37 sec. 2026-10-30 09:55:59 00205_emptyscalar_subquery_type_mismatch_bug: [ OK ] 0.32 sec. 2026-10-30 09:55:59 02015_async_inserts_2: [ OK ] 2.93 sec. 2026-10-30 09:55:59 00048_b_stored_aggregates_merge: [ OK ] 0.37 sec. 2026-10-30 09:55:59 00616_final_single_part: [ OK ] 0.37 sec. 2026-10-30 09:55:59 00811_garbage: [ OK ] 0.32 sec. 2026-10-30 09:56:00 03206_is_null_constant_result_old_analyzer_bug: [ OK ] 0.37 sec. 2026-10-30 09:56:00 01055_prewhere_bugs: [ OK ] 0.37 sec. 2026-10-30 09:56:01 01104_distributed_numbers_test: [ OK ] 0.37 sec. 2026-10-30 09:56:01 02465_limit_trivial_max_rows_to_read: [ OK ] 0.37 sec. 2026-10-30 09:56:01 01925_map_populate_series_on_map: [ OK ] 0.47 sec. 2026-10-30 09:56:02 01442_merge_detach_attach_long: [ OK ] 33.31 sec. 2026-10-30 09:56:02 02813_any_value: [ OK ] 0.32 sec. 2026-10-30 09:56:02 01701_clear_projection_and_part_remove: [ OK ] 0.37 sec. 2026-10-30 09:56:02 02304_grouping_set_order_by: [ OK ] 0.27 sec. 2026-10-30 09:56:02 00600_create_temporary_table_if_not_exists: [ OK ] 0.32 sec. 2026-10-30 09:56:02 01825_new_type_json_7: [ OK ] 3.28 sec. 2026-10-30 09:56:03 01284_escape_sequences_php_mysql_style: [ OK ] 0.32 sec. 2026-10-30 09:56:04 01017_mutations_with_nondeterministic_functions_zookeeper: [ OK ] 4.53 sec. 2026-10-30 09:56:04 02118_deserialize_whole_text: [ OK ] 6.84 sec. 2026-10-30 09:56:04 01383_log_broken_table: [ OK ] 25.03 sec. 2026-10-30 09:56:04 00402_nan_and_extremes: [ OK ] 0.32 sec. 2026-10-30 09:56:05 00063_check_query: [ OK ] 0.32 sec. 2026-10-30 09:56:05 03018_external_with_complex_data_types: [ OK ] 1.98 sec. 2026-10-30 09:56:05 02835_join_step_explain: [ OK ] 0.32 sec. 2026-10-30 09:56:05 01554_interpreter_integer_float: [ OK ] 0.27 sec. 2026-10-30 09:56:05 02466_distributed_query_profiler: [ OK ] 1.17 sec. 2026-10-30 09:56:05 02457_filesystem_function: [ OK ] 0.33 sec. 2026-10-30 09:56:05 02478_window_frame_type_groups: [ OK ] 0.32 sec. 2026-10-30 09:56:05 02956_rocksdb_with_ttl: [ OK ] 3.33 sec. 2026-10-30 09:56:06 02317_functions_with_nothing: [ OK ] 0.32 sec. 2026-10-30 09:56:06 01620_fix_simple_state_arg_type: [ OK ] 0.37 sec. 2026-10-30 09:56:06 01458_count_digits: [ OK ] 0.32 sec. 2026-10-30 09:56:06 02455_extract_fixed_string_from_nested_json: [ OK ] 0.32 sec. 2026-10-30 09:56:06 01264_nested_baloo_bear: [ OK ] 0.32 sec. 2026-10-30 09:56:06 02752_space_function: [ OK ] 0.47 sec. 2026-10-30 09:56:07 01287_max_execution_speed: [ OK ] 4.38 sec. 2026-10-30 09:56:07 02150_index_hypothesis_race_long: [ OK ] 12.20 sec. 2026-10-30 09:56:07 03034_recursive_cte_tree: [ OK ] 0.32 sec. 2026-10-30 09:56:07 01441_array_combinator: [ OK ] 0.27 sec. 2026-10-30 09:56:07 03037_dynamic_merges_1_horizontal_compact_wide_tree: [ SKIPPED ] 0.00 sec. 2026-10-30 09:56:07 Reason: not running for current build 2026-10-30 09:56:07 01686_rocksdb: [ OK ] 0.42 sec. 2026-10-30 09:56:07 01783_merge_engine_join_key_condition: [ OK ] 0.37 sec. 2026-10-30 09:56:07 01825_type_json_4: [ OK ] 3.93 sec. 2026-10-30 09:56:08 00627_recursive_alias: [ OK ] 0.27 sec. 2026-10-30 09:56:08 02152_dictionary_date32_type: [ OK ] 0.32 sec. 2026-10-30 09:56:08 00098_l_union_all: [ OK ] 0.27 sec. 2026-10-30 09:56:08 02842_suggest_http_page_in_error_message: [ OK ] 1.77 sec. 2026-10-30 09:56:08 01262_low_cardinality_remove: [ OK ] 0.37 sec. 2026-10-30 09:56:08 02025_having_filter_column: [ OK ] 0.32 sec. 2026-10-30 09:56:08 01880_materialized_view_to_table_type_check: [ OK ] 0.32 sec. 2026-10-30 09:56:08 01010_pmj_on_disk: [ OK ] 0.32 sec. 2026-10-30 09:56:08 02306_window_move_row_number_fix: [ OK ] 0.27 sec. 2026-10-30 09:56:09 03019_numbers_pretty: [ OK ] 0.27 sec. 2026-10-30 09:56:09 02250_lots_of_columns_in_csv_with_names: [ OK ] 3.23 sec. 2026-10-30 09:56:09 01915_merge_prewhere_virtual_column_rand_chao_wang: [ OK ] 0.32 sec. 2026-10-30 09:56:09 02155_parse_date_lowcard_default_throw: [ OK ] 0.27 sec. 2026-10-30 09:56:09 02251_last_day_of_month: [ OK ] 0.27 sec. 2026-10-30 09:56:09 03071_analyzer_array_join_forbid_non_existing_columns: [ OK ] 0.27 sec. 2026-10-30 09:56:09 02724_persist_interval_type: [ OK ] 0.32 sec. 2026-10-30 09:56:10 01291_distributed_low_cardinality_memory_efficient: [ OK ] 0.32 sec. 2026-10-30 09:56:10 03015_peder1001: [ OK ] 0.32 sec. 2026-10-30 09:56:10 01196_max_parser_depth: [ OK ] 2.27 sec. 2026-10-30 09:56:10 01576_if_null_external_aggregation: [ OK ] 3.33 sec. 2026-10-30 09:56:11 02974_backup_query_format_null: [ OK ] 2.77 sec. 2026-10-30 09:56:11 02499_analyzer_set_index: [ OK ] 0.32 sec. 2026-10-30 09:56:11 00111_shard_external_sort_distributed: [ OK ] 16.16 sec. 2026-10-30 09:56:12 00700_decimal_empty_aggregates: [ OK ] 0.62 sec. 2026-10-30 09:56:12 02250_ON_CLUSTER_grant: [ OK ] 3.02 sec. 2026-10-30 09:56:12 01868_order_by_fill_with_datetime64: [ OK ] 0.32 sec. 2026-10-30 09:56:12 03151_pmj_join_non_procssed_clash: [ OK ] 0.42 sec. 2026-10-30 09:56:12 00804_test_custom_compression_codes_log_storages: [ OK ] 0.62 sec. 2026-10-30 09:56:12 03208_inconsistent_formatting_of_not_subquery: [ OK ] 2.07 sec. 2026-10-30 09:56:12 01043_categorical_iv: [ OK ] 0.42 sec. 2026-10-30 09:56:13 03153_format_regexp_usability: [ OK ] 2.53 sec. 2026-10-30 09:56:13 03273_dynamic_pretty_json_serialization: [ OK ] 0.27 sec. 2026-10-30 09:56:13 01893_jit_aggregation_function_min_long: [ OK ] 0.97 sec. 2026-10-30 09:56:13 01939_network_receive_bytes_metrics: [ OK ] 2.98 sec. 2026-10-30 09:56:13 00062_replicated_merge_tree_alter_zookeeper_long: [ OK ] 0.97 sec. 2026-10-30 09:56:13 00450_higher_order_and_nullable: [ OK ] 0.32 sec. 2026-10-30 09:56:13 02722_matcher_join_use_nulls: [ OK ] 0.67 sec. 2026-10-30 09:56:14 02883_array_scalar_mult_div_modulo: [ OK ] 0.42 sec. 2026-10-30 09:56:14 00940_order_by_read_in_order: [ OK ] 0.52 sec. 2026-10-30 09:56:14 02026_accurate_cast_or_default: [ OK ] 0.47 sec. 2026-10-30 09:56:14 00569_parse_date_time_best_effort: [ OK ] 0.32 sec. 2026-10-30 09:56:14 01681_bloom_filter_nullable_column: [ OK ] 0.47 sec. 2026-10-30 09:56:14 02227_union_match_by_name: [ OK ] 0.32 sec. 2026-10-30 09:56:14 02482_execute_functions_before_sorting_bug: [ OK ] 0.32 sec. 2026-10-30 09:56:15 03161_ipv4_ipv6_equality: [ OK ] 0.37 sec. 2026-10-30 09:56:15 01631_date_overflow_as_partition_key: [ OK ] 0.32 sec. 2026-10-30 09:56:15 02731_replace_partition_from_temporary_table: [ OK ] 1.67 sec. 2026-10-30 09:56:15 01906_partition_by_multiply_by_zero: [ OK ] 0.32 sec. 2026-10-30 09:56:15 02710_protobuf_ipv4_date32: [ OK ] 2.68 sec. 2026-10-30 09:56:15 02921_fuzzbits_with_array_join: [ OK ] 0.32 sec. 2026-10-30 09:56:16 01710_order_by_projections_incomplete: [ OK ] 0.37 sec. 2026-10-30 09:56:16 02715_or_null: [ OK ] 0.32 sec. 2026-10-30 09:56:16 02096_totals_global_in_bug: [ OK ] 0.32 sec. 2026-10-30 09:56:16 00125_array_element_of_array_of_tuple: [ OK ] 0.27 sec. 2026-10-30 09:56:16 03165_storage_merge_view_prewhere: [ OK ] 0.42 sec. 2026-10-30 09:56:16 03001_block_offset_column: [ OK ] 0.52 sec. 2026-10-30 09:56:16 01926_date_date_time_supertype: [ OK ] 0.32 sec. 2026-10-30 09:56:17 00098_j_union_all: [ OK ] 0.32 sec. 2026-10-30 09:56:17 03031_input_format_allow_errors_num_bad_escape_sequence: [ OK ] 0.27 sec. 2026-10-30 09:56:17 01030_limit_by_with_ties_error: [ OK ] 2.93 sec. 2026-10-30 09:56:17 02982_parallel_replicas_unexpected_cluster: [ OK ] 0.37 sec. 2026-10-30 09:56:17 00843_optimize_predicate_and_rename_table: [ OK ] 0.37 sec. 2026-10-30 09:56:17 00568_empty_function_with_fixed_string: [ OK ] 0.32 sec. 2026-10-30 09:56:17 00672_arrayDistinct: [ OK ] 0.37 sec. 2026-10-30 09:56:18 01339_client_unrecognized_option: [ OK ] 3.13 sec. 2026-10-30 09:56:18 02387_parse_date_as_datetime: [ OK ] 0.32 sec. 2026-10-30 09:56:18 01880_remote_ipv6: [ OK ] 0.42 sec. 2026-10-30 09:56:18 01825_new_type_json_add_column: [ OK ] 0.47 sec. 2026-10-30 09:56:18 00957_neighbor: [ OK ] 0.47 sec. 2026-10-30 09:56:19 00938_dataset_test: [ OK ] 0.27 sec. 2026-10-30 09:56:19 00066_group_by_in: [ OK ] 0.32 sec. 2026-10-30 09:56:20 02864_restore_table_with_broken_part: [ OK ] 3.53 sec. 2026-10-30 09:56:21 01406_carriage_return_in_tsv_csv: [ OK ] 3.43 sec. 2026-10-30 09:56:21 00471_sql_style_quoting: [ OK ] 0.27 sec. 2026-10-30 09:56:21 00910_client_window_size_detection: [ OK ] 2.32 sec. 2026-10-30 09:56:21 01663_aes_msan: [ OK ] 0.32 sec. 2026-10-30 09:56:21 03198_unload_primary_key_outdated: [ OK ] 4.38 sec. 2026-10-30 09:56:21 01098_msgpack_format: [ OK ] 16.51 sec. 2026-10-30 09:56:22 01446_json_strings_each_row: [ OK ] 9.29 sec. 2026-10-30 09:56:22 03002_map_array_functions_with_low_cardinality: [ OK ] 0.27 sec. 2026-10-30 09:56:22 01825_type_json_18: [ OK ] 0.37 sec. 2026-10-30 09:56:22 01380_nullable_state: [ OK ] 0.72 sec. 2026-10-30 09:56:22 01532_tuple_with_name_type: [ OK ] 0.37 sec. 2026-10-30 09:56:22 02235_check_table_sparse_serialization: [ OK ] 0.32 sec. 2026-10-30 09:56:22 01673_test_toMinute_mysql_dialect: [ OK ] 0.27 sec. 2026-10-30 09:56:22 00104_totals_having_mode: [ OK ] 0.42 sec. 2026-10-30 09:56:22 01532_primary_key_without_order_by_zookeeper: [ OK ] 0.62 sec. 2026-10-30 09:56:22 02436_system_zookeeper_context: [ OK ] 0.37 sec. 2026-10-30 09:56:22 02553_type_object_analyzer: [ OK ] 0.32 sec. 2026-10-30 09:56:22 03204_format_join_on: [ OK ] 2.63 sec. 2026-10-30 09:56:22 02515_analyzer_null_for_empty: [ OK ] 0.27 sec. 2026-10-30 09:56:22 03143_join_filter_push_down_filled_join_fix: [ OK ] 0.32 sec. 2026-10-30 09:56:23 02302_clash_const_aggegate_join: [ OK ] 0.37 sec. 2026-10-30 09:56:23 02125_transform_decimal_bug: [ OK ] 0.32 sec. 2026-10-30 09:56:23 00421_storage_merge__table_index: [ OK ] 13.30 sec. 2026-10-30 09:56:23 02918_join_pm_lc_crash: [ OK ] 0.32 sec. 2026-10-30 09:56:23 02133_final_prewhere_where_lowcardinality_replacing: [ OK ] 0.42 sec. 2026-10-30 09:56:23 01558_transform_null_in: [ OK ] 0.37 sec. 2026-10-30 09:56:23 02677_analyzer_compound_expressions: [ OK ] 0.47 sec. 2026-10-30 09:56:23 02366_kql_mvexpand: [ OK ] 0.37 sec. 2026-10-30 09:56:25 01926_order_by_desc_limit: [ OK ] 1.67 sec. 2026-10-30 09:56:25 02531_two_level_aggregation_bug: [ OK ] 2.73 sec. 2026-10-30 09:56:25 02784_projections_read_in_order_bug: [ OK ] 0.32 sec. 2026-10-30 09:56:25 02918_gorilla_invalid_file: [ OK ] 1.97 sec. 2026-10-30 09:56:25 01088_benchmark_query_id: [ OK ] 2.83 sec. 2026-10-30 09:56:25 01890_state_of_state: [ OK ] 0.47 sec. 2026-10-30 09:56:25 02316_const_string_intersact: [ OK ] 0.27 sec. 2026-10-30 09:56:26 00652_replicated_mutations_default_database_zookeeper: [ OK ] 2.93 sec. 2026-10-30 09:56:26 02021_prewhere_column_optimization: [ OK ] 0.32 sec. 2026-10-30 09:56:26 02325_dates_schema_inference: [ OK ] 0.47 sec. 2026-10-30 09:56:26 00695_pretty_max_column_pad_width: [ OK ] 0.32 sec. 2026-10-30 09:56:26 02244_ip_address_invalid_insert: [ OK ] 0.52 sec. 2026-10-30 09:56:26 00834_date_datetime_cmp: [ OK ] 0.32 sec. 2026-10-30 09:56:26 01414_low_cardinality_nullable: [ OK ] 0.97 sec. 2026-10-30 09:56:26 02232_partition_pruner_mixed_constant_type: [ OK ] 0.32 sec. 2026-10-30 09:56:26 00960_eval_ml_method_const: [ OK ] 0.27 sec. 2026-10-30 09:56:27 00957_delta_diff_bug: [ OK ] 0.32 sec. 2026-10-30 09:56:27 02373_datetime64_monotonicity: [ OK ] 3.83 sec. 2026-10-30 09:56:27 03041_select_with_query_result: [ OK ] 0.37 sec. 2026-10-30 09:56:27 00999_join_not_nullable_types: [ OK ] 0.27 sec. 2026-10-30 09:56:27 03215_multilinestring_geometry: [ OK ] 0.37 sec. 2026-10-30 09:56:27 02798_generic_transform: [ OK ] 0.32 sec. 2026-10-30 09:56:27 00745_compile_scalar_subquery: [ OK ] 0.37 sec. 2026-10-30 09:56:27 01825_type_json_2: [ OK ] 0.47 sec. 2026-10-30 09:56:27 01626_cnf_test: [ OK ] 0.32 sec. 2026-10-30 09:56:27 02234_position_case_insensitive_utf8: [ OK ] 0.27 sec. 2026-10-30 09:56:28 00914_replicate: [ OK ] 0.32 sec. 2026-10-30 09:56:28 02246_flatten_tuple: [ OK ] 0.32 sec. 2026-10-30 09:56:28 01131_max_rows_to_sort: [ OK ] 0.37 sec. 2026-10-30 09:56:29 02972_insert_deduplication_token_hierarchical_inserts: [ OK ] 3.68 sec. 2026-10-30 09:56:29 00712_prewhere_with_alias_bug_2: [ OK ] 0.32 sec. 2026-10-30 09:56:29 00613_shard_distributed_max_execution_time: [ OK ] 0.32 sec. 2026-10-30 09:56:29 02493_inconsistent_hex_and_binary_number: [ OK ] 3.23 sec. 2026-10-30 09:56:30 01798_having_push_down: [ OK ] 0.37 sec. 2026-10-30 09:56:30 00999_nullable_nested_types_4877: [ OK ] 0.37 sec. 2026-10-30 09:56:30 02031_format_query_option: [ OK ] 2.03 sec. 2026-10-30 09:56:30 01837_cast_to_array_from_empty_array: [ OK ] 0.27 sec. 2026-10-30 09:56:30 02560_window_ntile: [ OK ] 0.52 sec. 2026-10-30 09:56:30 00620_optimize_on_nonleader_replica_zookeeper: [ OK ] 0.47 sec. 2026-10-30 09:56:31 03037_dot_product_overflow: [ OK ] 0.27 sec. 2026-10-30 09:56:31 02013_zlib_read_after_eof: [ OK ] 3.68 sec. 2026-10-30 09:56:31 03038_nested_dynamic_merges_wide_vertical: [ SKIPPED ] 0.00 sec. 2026-10-30 09:56:31 Reason: not running for current build 2026-10-30 09:56:31 01442_h3kring_range_check: [ OK ] 0.37 sec. 2026-10-30 09:56:31 03215_varian_as_common_type_tuple_map: [ OK ] 0.33 sec. 2026-10-30 09:56:31 00926_adaptive_index_granularity_collapsing_merge_tree: [ OK ] 0.42 sec. 2026-10-30 09:56:31 01558_enum_as_num_in_tsv_csv_input: [ OK ] 0.38 sec. 2026-10-30 09:56:31 01072_select_constant_limit: [ OK ] 0.28 sec. 2026-10-30 09:56:32 01136_multiple_sets: [ OK ] 0.33 sec. 2026-10-30 09:56:32 00086_concat_nary_const_with_nonconst_segfault: [ OK ] 0.52 sec. 2026-10-30 09:56:32 02024_create_dictionary_with_comment: [ OK ] 0.32 sec. 2026-10-30 09:56:32 03135_keeper_client_find_commands: [ OK ] 5.11 sec. 2026-10-30 09:56:33 01533_distinct_depends_on_max_threads: [ OK ] 0.53 sec. 2026-10-30 09:56:33 02294_dictionaries_hierarchical_index: [ OK ] 0.43 sec. 2026-10-30 09:56:33 01072_optimize_skip_unused_shards_const_expr_eval: [ OK ] 0.75 sec. 2026-10-30 09:56:34 02133_issue_32458: [ OK ] 0.36 sec. 2026-10-30 09:56:34 02457_tuple_of_intervals: [ OK ] 0.67 sec. 2026-10-30 09:56:34 01279_empty_external_table: [ OK ] 2.87 sec. 2026-10-30 09:56:34 03325_alter_modify_projection_primary_key_column: [ OK ] 0.78 sec. 2026-10-30 09:56:34 02842_table_function_file_filter_by_virtual_columns: [ OK ] 2.59 sec. 2026-10-30 09:56:35 02226_low_cardinality_text_bloom_filter_index: [ OK ] 0.74 sec. 2026-10-30 09:56:35 02675_predicate_push_down_filled_join_fix: [ OK ] 0.38 sec. 2026-10-30 09:56:35 02354_with_statement_non_exist_column: [ OK ] 0.33 sec. 2026-10-30 09:56:35 00752_low_cardinality_lambda_argument: [ OK ] 0.33 sec. 2026-10-30 09:56:35 02025_nested_func_for_if_combinator: [ OK ] 0.40 sec. 2026-10-30 09:56:35 02963_single_value_destructor: [ OK ] 0.44 sec. 2026-10-30 09:56:35 02293_grouping_function_group_by: [ OK ] 0.54 sec. 2026-10-30 09:56:36 01710_projection_with_nullable_keys: [ OK ] 0.32 sec. 2026-10-30 09:56:36 01801_s3_cluster_count: [ OK ] 0.39 sec. 2026-10-30 09:56:36 01540_verbatim_partition_pruning: [ OK ] 0.42 sec. 2026-10-30 09:56:36 02233_with_total_empty_chunk: [ OK ] 0.28 sec. 2026-10-30 09:56:36 02995_index_10: [ SKIPPED ] 0.00 sec. 2026-10-30 09:56:36 Reason: not running for current build 2026-10-30 09:56:36 01519_topK_distributed_parametrized: [ OK ] 0.37 sec. 2026-10-30 09:56:36 01404_roundUpToPowerOfTwoOrZero_safety: [ OK ] 0.37 sec. 2026-10-30 09:56:36 02688_long_aggregate_function_names: [ OK ] 0.29 sec. 2026-10-30 09:56:37 02875_fix_column_decimal_serialization: [ OK ] 0.42 sec. 2026-10-30 09:56:37 01497_mutation_support_for_storage_memory: [ OK ] 0.39 sec. 2026-10-30 09:56:37 03018_analyzer_distributed_query_with_positional_arguments: [ OK ] 0.37 sec. 2026-10-30 09:56:37 01839_join_to_subqueries_rewriter_columns_matcher: [ OK ] 0.32 sec. 2026-10-30 09:56:37 02940_json_array_of_unnamed_tuples_inference: [ OK ] 0.35 sec. 2026-10-30 09:56:37 02880_indexHint__partition_id: [ OK ] 0.32 sec. 2026-10-30 09:56:37 00980_full_join_crash_fancyqlx: [ OK ] 0.42 sec. 2026-10-30 09:56:37 00324_hashing_enums: [ OK ] 0.33 sec. 2026-10-30 09:56:38 02974_if_with_map: [ OK ] 0.39 sec. 2026-10-30 09:56:38 02325_compatibility_setting_2: [ OK ] 0.33 sec. 2026-10-30 09:56:38 01276_alter_rename_column_materialized_expr: [ OK ] 0.57 sec. 2026-10-30 09:56:38 01866_bit_positions_to_array: [ OK ] 0.47 sec. 2026-10-30 09:56:38 03271_decimal_monotonic_day_of_week: [ OK ] 0.32 sec. 2026-10-30 09:56:38 01097_one_more_range_reader_test_wide_part: [ OK ] 0.37 sec. 2026-10-30 09:56:39 01670_distributed_bytes_to_throw_insert: [ OK ] 0.38 sec. 2026-10-30 09:56:39 02560_count_digits: [ OK ] 0.38 sec. 2026-10-30 09:56:39 03207_composite_expressions_lambda_consistent_formatting: [ OK ] 0.32 sec. 2026-10-30 09:56:39 02477_analyzer_array_join_with_join: [ OK ] 0.52 sec. 2026-10-30 09:56:40 03197_storage_join_strictness_type_restriction: [ OK ] 0.33 sec. 2026-10-30 09:56:40 00446_clear_column_in_partition_concurrent_zookeeper: [ OK ] 16.19 sec. 2026-10-30 09:56:40 01634_summap_nullable: [ OK ] 0.37 sec. 2026-10-30 09:56:40 02455_default_union_except_intersect: [ OK ] 2.48 sec. 2026-10-30 09:56:41 02124_buffer_with_type_map_long: [ OK ] 12.78 sec. 2026-10-30 09:56:41 02581_width_bucket: [ OK ] 0.59 sec. 2026-10-30 09:56:41 01650_fetch_patition_with_macro_in_zk_path_long: [ OK ] 0.42 sec. 2026-10-30 09:56:41 02741_hashed_dictionary_load_factor: [ OK ] 0.97 sec. 2026-10-30 09:56:41 03217_filtering_in_storage_merge: [ OK ] 0.32 sec. 2026-10-30 09:56:42 01018_Distributed__shard_num: [ OK ] 0.62 sec. 2026-10-30 09:56:42 02474_extract_fixedstring_from_json: [ OK ] 0.37 sec. 2026-10-30 09:56:42 01283_max_threads_simple_query_optimization: [ OK ] 1.12 sec. 2026-10-30 09:56:43 00335_bom: [ OK ] 1.92 sec. 2026-10-30 09:56:43 01700_system_zookeeper_path_in: [ OK ] 0.37 sec. 2026-10-30 09:56:43 02125_lz4_compression_bug_Values: [ OK ] 8.25 sec. 2026-10-30 09:56:43 02871_join_on_system_errors: [ OK ] 0.32 sec. 2026-10-30 09:56:43 01499_json_named_tuples: [ OK ] 0.32 sec. 2026-10-30 09:56:43 02122_parallel_formatting_JSONCompact: [ OK ] 3.48 sec. 2026-10-30 09:56:43 00152_totals_in_subquery: [ OK ] 0.32 sec. 2026-10-30 09:56:43 03262_test_parquet_native_reader_int_logical_type: [ SKIPPED ] 0.00 sec. 2026-10-30 09:56:43 Reason: not running for current build 2026-10-30 09:56:43 01318_alter_add_column_exists: [ OK ] 0.37 sec. 2026-10-30 09:56:43 02098_date32_comparison: [ OK ] 0.32 sec. 2026-10-30 09:56:43 02953_slow_create_view: [ OK ] 0.37 sec. 2026-10-30 09:56:44 02181_sql_user_defined_functions_invalid_lambda: [ OK ] 0.32 sec. 2026-10-30 09:56:44 01016_macros: [ OK ] 0.32 sec. 2026-10-30 09:56:44 02326_numbers_from_json_strings_schema_inference: [ OK ] 0.32 sec. 2026-10-30 09:56:44 01821_join_table_mutation: [ OK ] 0.37 sec. 2026-10-30 09:56:44 02890_partition_prune_in_extra_columns: [ OK ] 0.27 sec. 2026-10-30 09:56:44 03039_dynamic_summing_merge_tree: [ OK ] 14.35 sec. 2026-10-30 09:56:44 01923_different_expression_name_alias: [ OK ] 0.37 sec. 2026-10-30 09:56:45 02180_group_by_lowcardinality: [ OK ] 0.32 sec. 2026-10-30 09:56:45 02029_quantile_sanitizer: [ OK ] 0.32 sec. 2026-10-30 09:56:45 03057_analyzer_subquery_alias_join: [ OK ] 0.37 sec. 2026-10-30 09:56:45 02941_projections_external_aggregation: [ OK ] 0.82 sec. 2026-10-30 09:56:45 00492_drop_temporary_table: [ OK ] 0.32 sec. 2026-10-30 09:56:45 01710_projections_partial_optimize_aggregation_in_order: [ OK ] 5.79 sec. 2026-10-30 09:56:46 00482_subqueries_and_aliases: [ OK ] 0.32 sec. 2026-10-30 09:56:46 01925_merge_prewhere_table: [ OK ] 0.37 sec. 2026-10-30 09:56:46 02457_csv_parse_date_out_of_range: [ OK ] 3.08 sec. 2026-10-30 09:56:46 03447_grouping_sets_analyzer_const_columns: [ OK ] 0.32 sec. 2026-10-30 09:56:46 02563_async_insert_bad_data: [ OK ] 2.93 sec. 2026-10-30 09:56:46 01922_sum_null_for_remote: [ OK ] 0.32 sec. 2026-10-30 09:56:46 00927_disable_hyperscan: [ OK ] 0.42 sec. 2026-10-30 09:56:47 01656_ipv4_bad_formatting: [ OK ] 0.27 sec. 2026-10-30 09:56:47 02906_flatten_only_true_nested: [ OK ] 0.32 sec. 2026-10-30 09:56:47 02377_analyzer_in_function_set: [ OK ] 0.32 sec. 2026-10-30 09:56:48 00805_round_down: [ OK ] 0.42 sec. 2026-10-30 09:56:48 01198_client_quota_key: [ OK ] 2.28 sec. 2026-10-30 09:56:48 01736_null_as_default: [ OK ] 0.27 sec. 2026-10-30 09:56:49 00976_max_execution_speed: [ OK ] 3.28 sec. 2026-10-30 09:56:49 02734_sparse_columns_mutation: [ OK ] 0.47 sec. 2026-10-30 09:56:49 02245_s3_virtual_columns: [ OK ] 0.37 sec. 2026-10-30 09:56:49 01922_array_join_with_index: [ OK ] 0.37 sec. 2026-10-30 09:56:49 00753_comment_columns_zookeeper: [ OK ] 0.37 sec. 2026-10-30 09:56:49 02586_generate_random_structure: [ OK ] 0.47 sec. 2026-10-30 09:56:50 02802_clickhouse_disks_s3_copy: [ OK ] 3.88 sec. 2026-10-30 09:56:51 01021_only_tuple_columns: [ OK ] 0.47 sec. 2026-10-30 09:56:51 02476_fix_lambda_parsing: [ OK ] 2.63 sec. 2026-10-30 09:56:51 01528_allow_nondeterministic_optimize_skip_unused_shards: [ OK ] 0.27 sec. 2026-10-30 09:56:51 03203_multiif_and_where_2_conditions_old_analyzer_bug: [ OK ] 0.37 sec. 2026-10-30 09:56:52 02493_analyzer_sum_if_to_count_if: [ OK ] 0.37 sec. 2026-10-30 09:56:52 01710_normal_projections: [ OK ] 7.34 sec. 2026-10-30 09:56:52 00905_compile_expressions_compare_big_dates: [ OK ] 0.32 sec. 2026-10-30 09:56:52 00763_long_lock_buffer_alter_destination_table: [ OK ] 33.50 sec. 2026-10-30 09:56:55 02815_no_throw_in_simple_queries: [ FAIL ] 4.03 sec. 2026-10-30 09:56:55 Reason: return code: 1 2026-10-30 09:56:55 send: spawn id exp3 not open 2026-10-30 09:56:55 while executing 2026-10-30 09:56:55 "send -- "exit\r"" 2026-10-30 09:56:55 , result: 2026-10-30 09:56:55 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 2026-10-30 09:56:55 stdout: 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 Failed 2026-10-30 09:56:55 2026-10-30 09:56:55 2026-10-30 09:56:55 Settings used in the test: --max_insert_threads 1 --group_by_two_level_threshold 1 --group_by_two_level_threshold_bytes 25968644 --distributed_aggregation_memory_efficient 1 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 7751282 --max_read_buffer_size 687517 --prefer_localhost_replica 0 --max_block_size 37570 --max_joined_block_size_rows 81692 --max_threads 32 --optimize_append_index 1 --optimize_if_chain_to_multiif 1 --optimize_if_transform_strings_to_enum 0 --optimize_read_in_order 0 --optimize_or_like_chain 0 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 0 --read_in_order_two_level_merge_threshold 13 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 15220847 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 632884389 --min_bytes_to_use_mmap_io 6199474805 --local_filesystem_read_method pread_threadpool --remote_filesystem_read_method threadpool --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 10 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 0 --filesystem_prefetch_step_bytes 100Mi --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 28 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 2186727033 --min_compress_block_size 1090075 --max_compress_block_size 26389 --merge_tree_compact_parts_min_granules_to_multibuffer_read 20 --optimize_sorting_by_input_stream_properties 1 --http_response_buffer_size 3550943 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 3 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone America/Hermosillo --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.67 --prefer_external_sort_block_bytes 0 --cross_join_min_rows_to_compress 100000000 --cross_join_min_bytes_to_compress 0 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 0 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 1 2026-10-30 09:56:55 2026-10-30 09:56:55 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 0.16842973176115406 --prefer_fetch_merged_part_size_threshold 1 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 1 --index_granularity_bytes 27478268 --merge_max_block_size 12777 --index_granularity 40461 --min_bytes_for_wide_part 1073741824 --marks_compress_block_size 51610 --primary_key_compress_block_size 8485 --replace_long_file_name_to_hash 1 --max_file_name_length 77 --min_bytes_for_full_part_storage 536870912 --compact_parts_max_bytes_to_buffer 527045191 --compact_parts_max_granules_to_buffer 202 --compact_parts_merge_max_bytes_to_prefetch_part 13520846 --cache_populated_by_fetch 1 --concurrent_part_removal_threshold 34 --old_parts_lifetime 480 2026-10-30 09:56:55 2026-10-30 09:56:55 Database: test_fwxj6568 2026-10-30 09:56:55 02562_native_tskv_default_for_omitted_fields: [ OK ] 5.48 sec. 2026-10-30 09:56:55 03156_analyzer_array_join_distributed: [ OK ] 0.47 sec. 2026-10-30 09:56:55 00059_shard_global_in_mergetree: [ OK ] 0.47 sec. 2026-10-30 09:56:56 01592_toUnixTimestamp_Date: [ OK ] 0.27 sec. 2026-10-30 09:56:56 02233_interpolate_1: [ OK ] 0.52 sec. 2026-10-30 09:56:57 02686_bson3: [ OK ] 0.32 sec. 2026-10-30 09:56:57 02162_array_first_last_index: [ OK ] 0.37 sec. 2026-10-30 09:56:57 02981_translate_fixedstring: [ OK ] 0.27 sec. 2026-10-30 09:56:58 02766_prql: [ OK ] 2.32 sec. 2026-10-30 09:56:58 05315_view_analyzer_setting_over_distributed: [ OK ] 0.42 sec. 2026-10-30 09:56:58 02426_pod_array_overflow_3: [ OK ] 0.27 sec. 2026-10-30 09:56:58 02751_multiquery_with_argument: [ OK ] 6.18 sec. 2026-10-30 09:57:01 00908_long_http_insert: [ OK ] 2.42 sec. 2026-10-30 09:57:01 00652_replicated_mutations_zookeeper: [ OK ] 11.50 sec. 2026-10-30 09:57:01 02111_with_fill_no_rows: [ OK ] 0.32 sec. 2026-10-30 09:57:02 00961_check_table: [ OK ] 0.37 sec. 2026-10-30 09:57:02 02016_bit_shift_right_for_string_integer: [ OK ] 0.72 sec. 2026-10-30 09:57:03 01661_test_toDayOfWeek_mysql_compatibility: [ OK ] 0.32 sec. 2026-10-30 09:57:03 01710_projection_detach_part: [ OK ] 0.32 sec. 2026-10-30 09:57:03 03093_with_fill_support_constant_expression: [ OK ] 0.32 sec. 2026-10-30 09:57:04 00679_replace_asterisk: [ OK ] 0.32 sec. 2026-10-30 09:57:04 01086_window_view_cleanup: [ OK ] 6.54 sec. 2026-10-30 09:57:04 02661_read_from_archive_targz: [ OK ] 11.85 sec. 2026-10-30 09:57:04 01300_wkt: [ OK ] 0.42 sec. 2026-10-30 09:57:05 01099_operators_date_and_timestamp: [ OK ] 0.67 sec. 2026-10-30 09:57:05 01072_drop_temporary_table_with_same_name: [ OK ] 0.42 sec. 2026-10-30 09:57:05 00732_quorum_insert_lost_part_zookeeper_long: [ OK ] 0.42 sec. 2026-10-30 09:57:05 03144_alter_column_and_read: [ OK ] 0.32 sec. 2026-10-30 09:57:05 02381_parse_array_of_tuples: [ OK ] 0.32 sec. 2026-10-30 09:57:05 02030_rocksdb_race_long: [ OK ] 22.53 sec. 2026-10-30 09:57:06 02242_if_then_else_null_bug: [ OK ] 0.27 sec. 2026-10-30 09:57:06 00903_array_with_constant_function: [ OK ] 0.27 sec. 2026-10-30 09:57:06 02267_special_operator_parse_alias_check: [ OK ] 0.42 sec. 2026-10-30 09:57:06 01268_mv_scalars: [ OK ] 0.42 sec. 2026-10-30 09:57:07 02353_compression_level: [ OK ] 8.15 sec. 2026-10-30 09:57:07 00942_dataparts_500: [ OK ] 1.88 sec. 2026-10-30 09:57:07 02560_tuple_format: [ OK ] 2.58 sec. 2026-10-30 09:57:08 03033_tupleIntXYZ_and_tupleModulo: [ OK ] 0.53 sec. 2026-10-30 09:57:08 01791_dist_INSERT_block_structure_mismatch: [ OK ] 2.03 sec. 2026-10-30 09:57:08 01521_alter_enum_and_reverse_read: [ OK ] 0.32 sec. 2026-10-30 09:57:08 00037_totals_limit: [ OK ] 0.27 sec. 2026-10-30 09:57:08 02967_parallel_replicas_join_algo_and_analyzer_2: [ OK ] 7.24 sec. 2026-10-30 09:57:08 01508_explain_header: [ OK ] 0.32 sec. 2026-10-30 09:57:08 01305_polygons_union: [ OK ] 0.37 sec. 2026-10-30 09:57:08 02864_statistics_delayed_materialization_in_merge: [ OK ] 0.42 sec. 2026-10-30 09:57:08 02374_in_tuple_index: [ OK ] 0.37 sec. 2026-10-30 09:57:08 02012_sha512_fixedstring: [ OK ] 0.32 sec. 2026-10-30 09:57:08 03166_optimize_row_order_during_insert: [ OK ] 0.42 sec. 2026-10-30 09:57:10 02877_optimize_read_in_order_from_view: [ OK ] 3.73 sec. 2026-10-30 09:57:10 02030_client_unknown_database: [ OK ] 2.08 sec. 2026-10-30 09:57:11 02517_avro_bool_type: [ OK ] 2.18 sec. 2026-10-30 09:57:11 01605_skip_idx_compact_parts: [ OK ] 0.32 sec. 2026-10-30 09:57:11 02843_date_predicate_optimizations_bugs: [ OK ] 0.27 sec. 2026-10-30 09:57:11 02841_group_array_sorted: [ OK ] 0.72 sec. 2026-10-30 09:57:12 02789_reading_from_s3_with_connection_pool: [ OK ] 4.93 sec. 2026-10-30 09:57:12 02994_sanity_check_settings: [ OK ] 0.32 sec. 2026-10-30 09:57:12 02817_structure_to_schema: [ OK ] 19.82 sec. 2026-10-30 09:57:12 03036_schema_inference_cache_s3_archives: [ OK ] 0.37 sec. 2026-10-30 09:57:12 01669_test_toYear_mysql_dialect: [ OK ] 0.27 sec. 2026-10-30 09:57:13 01183_custom_separated_format_http: [ OK ] 4.13 sec. 2026-10-30 09:57:13 03002_int_div_decimal_with_date_bug: [ OK ] 0.27 sec. 2026-10-30 09:57:13 02967_fuzz_bad_cast: [ OK ] 0.32 sec. 2026-10-30 09:57:15 00113_shard_group_array: [ OK ] 2.63 sec. 2026-10-30 09:57:16 01832_memory_write_suffix: [ OK ] 0.32 sec. 2026-10-30 09:57:17 00534_functions_bad_arguments8: [ OK ] 5.68 sec. 2026-10-30 09:57:18 01710_projections_order_by_complete: [ OK ] 0.32 sec. 2026-10-30 09:57:18 03208_array_of_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec. 2026-10-30 09:57:18 Reason: not running for current build 2026-10-30 09:57:18 02041_openssl_hash_functions_test: [ OK ] 0.32 sec. 2026-10-30 09:57:18 01954_clickhouse_benchmark_multiple_long: [ OK ] 9.75 sec. 2026-10-30 09:57:18 01278_variance_nonnegative: [ OK ] 0.52 sec. 2026-10-30 09:57:20 02115_write_buffers_finalize: [ OK ] 8.89 sec. 2026-10-30 09:57:20 02814_ReplacingMergeTree_fix_select_final_on_single_partition: [ OK ] 0.37 sec. 2026-10-30 09:57:21 00564_versioned_collapsing_merge_tree: [ OK ] 7.54 sec. 2026-10-30 09:57:21 03034_recursive_cte_tree_fuzz_crash_fix: [ OK ] 0.52 sec. 2026-10-30 09:57:21 02179_range_hashed_dictionary_invalid_interval: [ OK ] 0.37 sec. 2026-10-30 09:57:22 02481_i43247_ubsan_in_minmaxany: [ OK ] 0.37 sec. 2026-10-30 09:57:22 02980_s3_plain_DROP_TABLE_ReplicatedMergeTree: [ OK ] 4.23 sec. 2026-10-30 09:57:23 02843_context_has_expired: [ OK ] 0.37 sec. 2026-10-30 09:57:23 02124_encrypt_decrypt_nullable: [ OK ] 0.32 sec. 2026-10-30 09:57:24 01511_alter_version_versioned_collapsing_merge_tree: [ OK ] 0.42 sec. 2026-10-30 09:57:24 02383_array_signed_const_positive_index: [ OK ] 0.37 sec. 2026-10-30 09:57:24 02121_pager: [ OK ] 2.33 sec. 2026-10-30 09:57:26 02874_array_random_sample: [ OK ] 14.26 sec. 2026-10-30 09:57:26 03246_json_simd_rapid_parsers: [ OK ] 2.48 sec. 2026-10-30 09:57:27 01851_s2_to_geo: [ OK ] 0.27 sec. 2026-10-30 09:57:27 03093_filter_push_down_crash: [ OK ] 0.32 sec. 2026-10-30 09:57:27 01450_set_null_const: [ OK ] 0.32 sec. 2026-10-30 09:57:28 02900_buffer_table_alter_race: [ OK ] 9.55 sec. 2026-10-30 09:57:29 00417_kill_query: [ OK ] 4.33 sec. 2026-10-30 09:57:29 02496_row_binary_large_string_size: [ OK ] 2.23 sec. 2026-10-30 09:57:29 03130_convert_outer_join_to_inner_join: [ OK ] 0.37 sec. 2026-10-30 09:57:29 00527_totals_having_nullable: [ OK ] 0.27 sec. 2026-10-30 09:57:29 02157_readonly_system_suspend: [ OK ] 2.13 sec. 2026-10-30 09:57:29 01423_if_nullable_cond: [ OK ] 0.27 sec. 2026-10-30 09:57:30 00278_insert_already_sorted: [ OK ] 0.57 sec. 2026-10-30 09:57:30 03212_thousand_exceptions: [ OK ] 9.70 sec. 2026-10-30 09:57:30 02207_ttl_move_if_exists: [ OK ] 0.32 sec. 2026-10-30 09:57:30 02998_primary_key_skip_columns: [ SKIPPED ] 0.00 sec. 2026-10-30 09:57:30 Reason: not running for current build 2026-10-30 09:57:30 00516_deduplication_after_drop_partition_zookeeper: [ OK ] 0.47 sec. 2026-10-30 09:57:30 01882_scalar_subquery_exception: [ OK ] 0.32 sec. 2026-10-30 09:57:30 00177_inserts_through_http_parts: [ OK ] 1.87 sec. 2026-10-30 09:57:30 02554_log_faminy_support_storage_policy: [ OK ] 0.42 sec. 2026-10-30 09:57:30 02418_keeper_map_keys_limit: [ OK ] 0.37 sec. 2026-10-30 09:57:30 03033_dist_settings.optimize_skip_unused_shards_rewrite_in_composite_sharding_key: [ OK ] 0.32 sec. 2026-10-30 09:57:30 01079_alter_default_zookeeper_long: [ OK ] 0.62 sec. 2026-10-30 09:57:30 02811_insert_schema_inference: [ OK ] 0.32 sec. 2026-10-30 09:57:31 02969_analyzer_eliminate_injective_functions: [ OK ] 0.32 sec. 2026-10-30 09:57:31 02346_fulltext_index_bug52019: [ OK ] 0.37 sec. 2026-10-30 09:57:31 00050_any_left_join: [ OK ] 0.32 sec. 2026-10-30 09:57:31 02809_has_subsequence: [ OK ] 0.42 sec. 2026-10-30 09:57:31 02911_add_index_and_materialize_index: [ OK ] 0.27 sec. 2026-10-30 09:57:32 02290_client_insert_cancel: [ OK ] 2.48 sec. 2026-10-30 09:57:32 02131_used_row_policies_in_query_log: [ OK ] 0.82 sec. 2026-10-30 09:57:32 02421_truncate_isolation_no_merges: [ OK ] 21.78 sec. 2026-10-30 09:57:33 01818_case_float_value_fangyc: [ OK ] 0.27 sec. 2026-10-30 09:57:33 02475_join_bug_42832: [ OK ] 0.37 sec. 2026-10-30 09:57:33 03009_format_show_database: [ OK ] 2.53 sec. 2026-10-30 09:57:33 00666_uniq_complex_types: [ OK ] 0.42 sec. 2026-10-30 09:57:33 00147_alter_nested_default: [ OK ] 0.42 sec. 2026-10-30 09:57:33 02973_dictionary_table_exception_fix: [ OK ] 0.32 sec. 2026-10-30 09:57:33 01602_runningConcurrency: [ OK ] 0.47 sec. 2026-10-30 09:57:33 02995_index_6: [ SKIPPED ] 0.00 sec. 2026-10-30 09:57:33 Reason: not running for current build 2026-10-30 09:57:34 00860_unknown_identifier_bug: [ OK ] 0.32 sec. 2026-10-30 09:57:34 02494_array_function_range: [ OK ] 0.32 sec. 2026-10-30 09:57:34 00967_insert_into_distributed_different_types: [ OK ] 0.32 sec. 2026-10-30 09:57:35 02493_max_streams_for_merge_tree_reading: [ OK ] 0.92 sec. 2026-10-30 09:57:36 02122_parallel_formatting_Values: [ OK ] 3.43 sec. 2026-10-30 09:57:36 02894_ast_depth_check: [ OK ] 2.17 sec. 2026-10-30 09:57:36 01317_no_password_in_command_line: [ OK ] 5.64 sec. 2026-10-30 09:57:36 01550_query_identifier_parameters: [ OK ] 3.18 sec. 2026-10-30 09:57:37 00647_multiply_aggregation_state: [ OK ] 0.47 sec. 2026-10-30 09:57:37 00904_array_with_constant_2: [ OK ] 0.27 sec. 2026-10-30 09:57:37 00581_limit_on_result_and_subquery_and_insert: [ OK ] 0.37 sec. 2026-10-30 09:57:37 02999_scalar_subqueries_bug_1: [ OK ] 0.37 sec. 2026-10-30 09:57:37 03262_udf_in_constraint: [ OK ] 2.13 sec. 2026-10-30 09:57:37 03038_ambiguous_column: [ OK ] 0.32 sec. 2026-10-30 09:57:37 01104_fixed_string_like: [ OK ] 0.42 sec. 2026-10-30 09:57:37 02271_temporary_table_show_rows_bytes: [ OK ] 0.32 sec. 2026-10-30 09:57:38 02383_schema_inference_hints: [ OK ] 0.32 sec. 2026-10-30 09:57:38 00810_in_operators_segfault: [ OK ] 0.27 sec. 2026-10-30 09:57:38 02266_auto_add_nullable: [ OK ] 0.32 sec. 2026-10-30 09:57:38 01415_sticking_mutations: [ OK ] 22.33 sec. 2026-10-30 09:57:38 01412_row_from_totals: [ OK ] 0.42 sec. 2026-10-30 09:57:38 01956_skip_unavailable_shards_excessive_attempts: [ OK ] 2.78 sec. 2026-10-30 09:57:38 00210_insert_select_extremes_http: [ OK ] 2.02 sec. 2026-10-30 09:57:38 02990_arrayFold_nullable_lc: [ OK ] 0.42 sec. 2026-10-30 09:57:39 02784_move_all_conditions_to_prewhere_analyzer_asan: [ OK ] 0.32 sec. 2026-10-30 09:57:39 01710_projection_optimize_group_by_function_keys: [ OK ] 0.32 sec. 2026-10-30 09:57:39 00966_invalid_json_must_not_parse: [ OK ] 0.37 sec. 2026-10-30 09:57:39 02371_create_temporary_table_as_with_columns_list: [ OK ] 0.27 sec. 2026-10-30 09:57:39 01544_fromModifiedJulianDay: [ OK ] 0.42 sec. 2026-10-30 09:57:39 01259_dictionary_custom_settings_ddl: [ OK ] 0.42 sec. 2026-10-30 09:57:40 02967_index_hint_crash: [ OK ] 0.32 sec. 2026-10-30 09:57:40 03054_analyzer_join_alias: [ OK ] 0.32 sec. 2026-10-30 09:57:40 02879_use_structure_from_insertion_table_with_defaults: [ OK ] 2.38 sec. 2026-10-30 09:57:40 01085_simdjson_uint64: [ OK ] 0.27 sec. 2026-10-30 09:57:40 02947_dropped_tables_parts: [ OK ] 0.32 sec. 2026-10-30 09:57:40 00082_append_trailing_char_if_absent: [ OK ] 0.32 sec. 2026-10-30 09:57:40 01714_alter_drop_version: [ OK ] 0.37 sec. 2026-10-30 09:57:41 00835_if_generic_case: [ OK ] 0.37 sec. 2026-10-30 09:57:41 02999_analyzer_preimage_null: [ OK ] 0.32 sec. 2026-10-30 09:57:41 02860_distributed_flush_on_detach: [ OK ] 0.37 sec. 2026-10-30 09:57:41 00723_remerge_sort: [ OK ] 0.62 sec. 2026-10-30 09:57:42 01656_sequence_next_node_long: [ OK ] 2.53 sec. 2026-10-30 09:57:42 00725_join_on_bug_1: [ OK ] 0.32 sec. 2026-10-30 09:57:42 03032_storage_memory_modify_settings: [ OK ] 0.57 sec. 2026-10-30 09:57:42 01278_format_multiple_queries: [ OK ] 1.97 sec. 2026-10-30 09:57:42 00007_array: [ OK ] 0.32 sec. 2026-10-30 09:57:42 01825_type_json_field: [ OK ] 0.37 sec. 2026-10-30 09:57:42 02496_remove_redundant_sorting: [ OK ] 11.40 sec. 2026-10-30 09:57:42 01083_window_view_select: [ OK ] 3.68 sec. 2026-10-30 09:57:42 01513_defaults_on_defaults_no_column: [ OK ] 0.42 sec. 2026-10-30 09:57:42 01948_group_bitmap_and_or_xor_fix: [ OK ] 0.32 sec. 2026-10-30 09:57:42 01901_in_literal_shard_prune: [ OK ] 0.32 sec. 2026-10-30 09:57:42 03003_functions_to_subcolumns_final: [ OK ] 0.37 sec. 2026-10-30 09:57:42 00862_decimal_in: [ OK ] 0.37 sec. 2026-10-30 09:57:43 01632_nullable_string_type_convert_to_decimal_type: [ OK ] 0.27 sec. 2026-10-30 09:57:43 00098_7_union_all: [ OK ] 0.27 sec. 2026-10-30 09:57:43 02494_parser_string_binary_literal: [ OK ] 0.37 sec. 2026-10-30 09:57:43 01825_type_json_empty_string: [ OK ] 0.32 sec. 2026-10-30 09:57:43 02366_kql_func_ip: [ OK ] 1.02 sec. 2026-10-30 09:57:43 03121_analyzer_filed_redefenition_in_subquery: [ OK ] 0.27 sec. 2026-10-30 09:57:43 02416_json_tuple_to_array_schema_inference: [ OK ] 0.32 sec. 2026-10-30 09:57:43 01553_datetime64_comparison: [ OK ] 0.32 sec. 2026-10-30 09:57:43 02344_distinct_limit_distiributed: [ OK ] 0.92 sec. 2026-10-30 09:57:43 02007_ipv4_and_ipv6_to_and_from_string: [ OK ] 0.37 sec. 2026-10-30 09:57:43 02725_any_join_single_row: [ OK ] 0.37 sec. 2026-10-30 09:57:44 01430_modify_sample_by_zookeeper_long: [ OK ] 0.72 sec. 2026-10-30 09:57:44 03003_enum_and_string_compatible: [ OK ] 0.27 sec. 2026-10-30 09:57:44 03093_reading_bug_with_parallel_replicas: [ OK ] 0.52 sec. 2026-10-30 09:57:44 02155_dictionary_comment: [ OK ] 0.47 sec. 2026-10-30 09:57:44 01526_param_uuid: [ OK ] 2.08 sec. 2026-10-30 09:57:44 01213_alter_table_rename_nested: [ OK ] 0.37 sec. 2026-10-30 09:57:44 03217_datetime64_constant_to_ast: [ OK ] 0.27 sec. 2026-10-30 09:57:45 00931_low_cardinality_read_with_empty_array: [ OK ] 0.52 sec. 2026-10-30 09:57:45 02540_analyzer_matcher_alias_materialized_columns: [ OK ] 0.37 sec. 2026-10-30 09:57:45 03066_analyzer_global_with_statement: [ OK ] 0.27 sec. 2026-10-30 09:57:45 00637_sessions_in_http_interface_and_settings: [ OK ] 1.88 sec. 2026-10-30 09:57:45 01470_test_insert_select_asterisk: [ OK ] 0.37 sec. 2026-10-30 09:57:46 02477_invalid_reads: [ OK ] 0.87 sec. 2026-10-30 09:57:46 01442_date_time_with_params: [ OK ] 0.62 sec. 2026-10-30 09:57:46 01040_h3_get_resolution: [ OK ] 0.32 sec. 2026-10-30 09:57:46 00972_geohashesInBox: [ OK ] 0.77 sec. 2026-10-30 09:57:47 02701_invalid_having_NOT_AN_AGGREGATE: [ OK ] 0.32 sec. 2026-10-30 09:57:47 00080_show_tables_and_system_tables: [ OK ] 0.37 sec. 2026-10-30 09:57:47 00661_array_has_silviucpp: [ OK ] 0.32 sec. 2026-10-30 09:57:47 01040_dictionary_invalidate_query_switchover_long: [ OK ] 9.44 sec. 2026-10-30 09:57:47 02771_ignore_data_skipping_indices: [ OK ] 0.42 sec. 2026-10-30 09:57:48 01865_aggregator_overflow_row: [ OK ] 0.37 sec. 2026-10-30 09:57:48 03171_direct_dict_short_circuit_bug: [ OK ] 0.37 sec. 2026-10-30 09:57:48 01621_clickhouse_compressor: [ OK ] 2.87 sec. 2026-10-30 09:57:48 02408_to_fixed_string_short_circuit: [ OK ] 0.27 sec. 2026-10-30 09:57:48 03269_partition_key_not_in_set: [ OK ] 0.57 sec. 2026-10-30 09:57:48 01351_geohash_assert: [ OK ] 0.32 sec. 2026-10-30 09:57:48 02915_sleep_large_uint: [ OK ] 0.32 sec. 2026-10-30 09:57:48 03013_group_by_use_nulls_with_materialize_and_analyzer: [ OK ] 0.32 sec. 2026-10-30 09:57:49 02154_bitmap_contains: [ OK ] 0.27 sec. 2026-10-30 09:57:49 02931_size_virtual_column_use_structure_from_insertion_table: [ OK ] 2.13 sec. 2026-10-30 09:57:49 02723_jit_aggregation_bug_48120: [ OK ] 0.37 sec. 2026-10-30 09:57:49 03228_dynamic_serializations_uninitialized_value: [ OK ] 0.27 sec. 2026-10-30 09:57:49 00760_insert_json_with_defaults: [ OK ] 0.42 sec. 2026-10-30 09:57:49 01017_tuplehamming_distance: [ OK ] 0.32 sec. 2026-10-30 09:57:49 03209_json_type_merges_small: [ SKIPPED ] 0.00 sec. 2026-10-30 09:57:49 Reason: not running for current build 2026-10-30 09:57:49 00952_part_frozen_info: [ OK ] 0.32 sec. 2026-10-30 09:57:50 01825_new_type_json_parallel_insert: [ OK ] 0.87 sec. 2026-10-30 09:57:51 01674_clickhouse_client_query_param_cte: [ OK ] 2.22 sec. 2026-10-30 09:57:51 01802_toDateTime64_large_values: [ OK ] 0.37 sec. 2026-10-30 09:57:51 00227_quantiles_timing_arbitrary_order: [ OK ] 0.27 sec. 2026-10-30 09:57:51 00178_query_datetime64_index: [ OK ] 0.32 sec. 2026-10-30 09:57:51 01063_create_column_set: [ OK ] 0.27 sec. 2026-10-30 09:57:51 01520_client_print_query_id: [ OK ] 2.23 sec. 2026-10-30 09:57:52 02003_compress_bz2: [ OK ] 2.38 sec. 2026-10-30 09:57:52 03036_dynamic_read_subcolumns_memory: [ SKIPPED ] 0.00 sec. 2026-10-30 09:57:52 Reason: not running for current build 2026-10-30 09:57:52 00192_least_greatest: [ OK ] 0.32 sec. 2026-10-30 09:57:52 01804_uniq_up_to_ubsan: [ OK ] 0.27 sec. 2026-10-30 09:57:52 02687_native_fuzz: [ OK ] 0.27 sec. 2026-10-30 09:57:52 03129_cte_with_final: [ OK ] 0.32 sec. 2026-10-30 09:57:52 00260_like_and_curly_braces: [ OK ] 0.37 sec. 2026-10-30 09:57:52 03151_external_cross_join: [ OK ] 1.02 sec. 2026-10-30 09:57:52 01070_h3_to_parent: [ OK ] 0.27 sec. 2026-10-30 09:57:52 02240_asof_join_biginteger: [ OK ] 0.32 sec. 2026-10-30 09:57:52 00974_full_outer_join: [ OK ] 0.33 sec. 2026-10-30 09:57:53 00619_union_highlite: [ OK ] 0.32 sec. 2026-10-30 09:57:53 02228_merge_tree_insert_memory_usage: [ OK ] 1.02 sec. 2026-10-30 09:57:53 02932_query_settings_max_size_drop: [ OK ] 0.47 sec. 2026-10-30 09:57:54 02125_fix_storage_filelog: [ OK ] 0.32 sec. 2026-10-30 09:57:54 00346_if_tuple: [ OK ] 0.32 sec. 2026-10-30 09:57:54 03208_array_of_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec. 2026-10-30 09:57:54 Reason: not running for current build 2026-10-30 09:57:54 02931_file_cluster: [ OK ] 2.18 sec. 2026-10-30 09:57:55 02380_analyzer_join_sample: [ OK ] 0.32 sec. 2026-10-30 09:57:55 01603_remove_column_ttl: [ OK ] 0.32 sec. 2026-10-30 09:57:55 01288_shard_max_network_bandwidth: [ OK ] 2.78 sec. 2026-10-30 09:57:56 02011_tuple_vector_functions: [ OK ] 0.72 sec. 2026-10-30 09:57:56 03068_analyzer_distributed_join: [ OK ] 0.42 sec. 2026-10-30 09:57:56 02500_remove_redundant_distinct_analyzer: [ OK ] 12.01 sec. 2026-10-30 09:57:56 00589_removal_unused_columns_aggregation: [ OK ] 0.37 sec. 2026-10-30 09:57:56 01710_projection_in_set: [ OK ] 0.37 sec. 2026-10-30 09:57:56 01427_pk_and_expression_with_different_type: [ OK ] 0.27 sec. 2026-10-30 09:57:56 01326_hostname_alias: [ OK ] 0.27 sec. 2026-10-30 09:57:57 00180_attach_materialized_view: [ OK ] 0.32 sec. 2026-10-30 09:57:57 02071_lower_upper_utf8_row_overlaps: [ OK ] 0.32 sec. 2026-10-30 09:57:57 02515_and_or_if_multiif_not_return_lc: [ OK ] 0.27 sec. 2026-10-30 09:57:59 00601_kill_running_query: [ OK ] 1.88 sec. 2026-10-30 09:58:00 02931_ubsan_error_arena_aligned_alloc: [ OK ] 0.32 sec. 2026-10-30 09:58:00 02004_intersect_except_distinct_operators: [ OK ] 0.67 sec. 2026-10-30 09:58:01 00445_join_nullable_keys: [ OK ] 0.32 sec. 2026-10-30 09:58:01 00740_database_in_nested_view: [ OK ] 0.32 sec. 2026-10-30 09:58:01 00101_materialized_views_and_insert_without_explicit_database: [ OK ] 0.47 sec. 2026-10-30 09:58:02 03004_force_null_for_omitted: [ OK ] 0.52 sec. 2026-10-30 09:58:05 02233_HTTP_ranged: [ OK ] 2.53 sec. 2026-10-30 09:58:05 01359_codeql: [ OK ] 0.27 sec. 2026-10-30 09:58:05 02286_tuple_numeric_identifier: [ OK ] 0.37 sec. 2026-10-30 09:58:05 01079_order_by_pk: [ OK ] 9.75 sec. 2026-10-30 09:58:06 01293_external_sorting_limit_bug: [ OK ] 0.37 sec. 2026-10-30 09:58:06 02149_issue_32487: [ OK ] 0.27 sec. 2026-10-30 09:58:06 00131_set_hashed: [ OK ] 0.27 sec. 2026-10-30 09:58:06 00700_decimal_arithm: [ OK ] 0.92 sec. 2026-10-30 09:58:07 00002_system_numbers: [ OK ] 0.32 sec. 2026-10-30 09:58:07 02932_idna: [ OK ] 0.72 sec. 2026-10-30 09:58:07 02241_short_circuit_short_column: [ OK ] 0.27 sec. 2026-10-30 09:58:07 03058_analyzer_ambiguous_columns: [ OK ] 0.37 sec. 2026-10-30 09:58:07 03095_join_filter_push_down_right_stream_filled: [ OK ] 0.32 sec. 2026-10-30 09:58:08 02317_distinct_in_order_optimization_explain: [ OK ] 15.32 sec. 2026-10-30 09:58:09 00950_default_prewhere: [ OK ] 0.37 sec. 2026-10-30 09:58:09 02900_issue_55858: [ OK ] 0.43 sec. 2026-10-30 09:58:09 00686_client_exit_code: [ OK ] 2.07 sec. 2026-10-30 09:58:10 01269_create_with_null: [ OK ] 0.37 sec. 2026-10-30 09:58:10 03031_clickhouse_local_input: [ OK ] 2.93 sec. 2026-10-30 09:58:11 02998_http_redirects: [ OK ] 1.93 sec. 2026-10-30 09:58:12 01059_storage_file_compression: [ OK ] 18.53 sec. 2026-10-30 09:58:13 01774_bar_with_illegal_value: [ OK ] 0.32 sec. 2026-10-30 09:58:13 02336_sort_optimization_with_fill: [ OK ] 0.32 sec. 2026-10-30 09:58:13 00577_full_join_segfault: [ OK ] 0.32 sec. 2026-10-30 09:58:14 02498_storage_join_key_positions: [ OK ] 0.72 sec. 2026-10-30 09:58:14 01090_fixed_string_bit_ops: [ OK ] 0.32 sec. 2026-10-30 09:58:15 01604_explain_ast_of_nonselect_query: [ OK ] 0.29 sec. 2026-10-30 09:58:15 00702_join_on_dups: [ OK ] 0.47 sec. 2026-10-30 09:58:16 01790_dist_INSERT_block_structure_mismatch_types_and_names: [ OK ] 0.32 sec. 2026-10-30 09:58:16 00937_test_use_header_csv: [ OK ] 5.93 sec. 2026-10-30 09:58:16 02479_if_with_null_and_cullable_const: [ OK ] 0.27 sec. 2026-10-30 09:58:16 01051_window_view_parser_hop: [ OK ] 0.47 sec. 2026-10-30 09:58:16 00360_to_date_from_string_with_datetime: [ OK ] 0.27 sec. 2026-10-30 09:58:17 01710_projection_with_mixed_pipeline: [ OK ] 0.32 sec. 2026-10-30 09:58:17 01281_parseDateTime64BestEffort: [ OK ] 0.57 sec. 2026-10-30 09:58:18 03174_multiple_authentication_methods: [ OK ] 6.64 sec. 2026-10-30 09:58:18 01470_explain: [ OK ] 0.27 sec. 2026-10-30 09:58:19 00348_tuples: [ OK ] 0.37 sec. 2026-10-30 09:58:19 02498_random_string_in_json_schema_inference: [ OK ] 2.12 sec. 2026-10-30 09:58:19 02481_async_insert_dedup: [ OK ] 92.74 sec. 2026-10-30 09:58:20 00952_input_function: [ OK ] 9.75 sec. 2026-10-30 09:58:20 02559_multiple_read_steps_in_prewhere_fuzz: [ OK ] 0.33 sec. 2026-10-30 09:58:21 02915_fpc_overflow: [ OK ] 1.92 sec. 2026-10-30 09:58:21 02228_unquoted_dates_in_csv_schema_inference: [ OK ] 2.13 sec. 2026-10-30 09:58:21 01532_collate_in_low_cardinality: [ OK ] 0.37 sec. 2026-10-30 09:58:22 00534_functions_bad_arguments4_long: [ OK ] 5.14 sec. 2026-10-30 09:58:22 02235_add_part_offset_virtual_column: [ OK ] 1.23 sec. 2026-10-30 09:58:22 01052_array_reduce_exception: [ OK ] 0.27 sec. 2026-10-30 09:58:22 02006_test_positional_arguments_on_cluster: [ OK ] 0.67 sec. 2026-10-30 09:58:22 01774_case_sensitive_connection_id: [ OK ] 0.32 sec. 2026-10-30 09:58:22 00292_parser_tuple_element: [ OK ] 0.27 sec. 2026-10-30 09:58:22 01060_window_view_event_tumble_to_asc: [ OK ] 3.48 sec. 2026-10-30 09:58:23 00898_parsing_bad_diagnostic_message: [ OK ] 2.22 sec. 2026-10-30 09:58:23 01512_create_replicate_merge_tree_one_arg: [ OK ] 0.32 sec. 2026-10-30 09:58:23 01049_join_low_card_crash: [ OK ] 0.32 sec. 2026-10-30 09:58:23 00024_unused_array_join_in_subquery: [ OK ] 0.27 sec. 2026-10-30 09:58:23 00996_limit_with_ties: [ OK ] 0.37 sec. 2026-10-30 09:58:24 01272_suspicious_codecs: [ OK ] 0.62 sec. 2026-10-30 09:58:24 00143_number_classification_functions: [ OK ] 0.32 sec. 2026-10-30 09:58:24 02592_avro_more_types: [ OK ] 2.48 sec. 2026-10-30 09:58:25 01770_add_months_ubsan: [ OK ] 0.28 sec. 2026-10-30 09:58:25 02896_leading_zeroes_no_octal: [ OK ] 1.17 sec. 2026-10-30 09:58:25 01720_engine_file_empty_if_not_exists: [ OK ] 0.32 sec. 2026-10-30 09:58:25 00754_alter_modify_column_partitions: [ OK ] 0.53 sec. 2026-10-30 09:58:25 02464_decimal_scale_buffer_overflow: [ OK ] 0.32 sec. 2026-10-30 09:58:26 01710_projections_group_by_no_key: [ OK ] 0.39 sec. 2026-10-30 09:58:26 02918_analyzer_to_ast_crash: [ OK ] 0.27 sec. 2026-10-30 09:58:26 02233_optimize_aggregation_in_order_prefix: [ OK ] 0.32 sec. 2026-10-30 09:58:26 02563_progress_when_no_rows_from_prewhere: [ SKIPPED ] 0.00 sec. 2026-10-30 09:58:26 Reason: not running for current build 2026-10-30 09:58:27 01064_incremental_streaming_from_2_src_with_feedback: [ OK ] 1.22 sec. 2026-10-30 09:58:27 01825_type_json_from_map: [ OK ] 3.23 sec. 2026-10-30 09:58:27 03010_read_system_parts_table_test: [ OK ] 0.37 sec. 2026-10-30 09:58:28 00014_select_from_table_with_nested: [ OK ] 0.32 sec. 2026-10-30 09:58:28 02582_analyzer_join_subquery_empty_column_list: [ OK ] 0.32 sec. 2026-10-30 09:58:28 00809_add_days_segfault: [ OK ] 0.37 sec. 2026-10-30 09:58:29 02565_analyzer_limit_settings: [ OK ] 0.32 sec. 2026-10-30 09:58:29 02952_clickhouse_local_query_parameters_cli: [ OK ] 2.18 sec. 2026-10-30 09:58:29 03013_position_const_start_pos: [ OK ] 0.32 sec. 2026-10-30 09:58:29 00698_validate_array_sizes_for_nested: [ OK ] 0.32 sec. 2026-10-30 09:58:30 01528_to_uuid_or_null_or_zero: [ OK ] 0.37 sec. 2026-10-30 09:58:30 01034_move_partition_from_table_zookeeper: [ OK ] 46.26 sec. 2026-10-30 09:58:30 01076_range_reader_segfault: [ OK ] 0.37 sec. 2026-10-30 09:58:31 02377_optimize_sorting_by_input_stream_properties: [ OK ] 0.47 sec. 2026-10-30 09:58:31 02833_local_udf_options: [ OK ] 2.12 sec. 2026-10-30 09:58:31 01034_with_fill_and_push_down_predicate: [ OK ] 0.27 sec. 2026-10-30 09:58:31 02695_logical_optimizer_alias_bug: [ OK ] 0.32 sec. 2026-10-30 09:58:32 02876_s3_cluster_schema_inference_names_with_spaces: [ OK ] 0.32 sec. 2026-10-30 09:58:33 01526_initial_query_id: [ OK ] 2.98 sec. 2026-10-30 09:58:33 02482_insert_into_dist_race: [ OK ] 0.32 sec. 2026-10-30 09:58:34 01654_test_writer_block_sequence: [ OK ] 11.60 sec. 2026-10-30 09:58:34 01882_check_max_parts_to_merge_at_once: [ OK ] 1.12 sec. 2026-10-30 09:58:34 00072_in_types: [ OK ] 0.27 sec. 2026-10-30 09:58:34 02995_preliminary_filters_duplicated_columns: [ OK ] 0.33 sec. 2026-10-30 09:58:35 02207_s3_content_type: [ OK ] 2.88 sec. 2026-10-30 09:58:35 00120_join_and_group_by: [ OK ] 0.32 sec. 2026-10-30 09:58:35 00622_select_in_parens: [ OK ] 0.32 sec. 2026-10-30 09:58:35 02809_prewhere_and_in: [ OK ] 0.42 sec. 2026-10-30 09:58:35 01496_signedness_conversion_monotonicity: [ OK ] 0.33 sec. 2026-10-30 09:58:36 02372_now_in_block: [ OK ] 0.72 sec. 2026-10-30 09:58:36 02971_functions_to_subcolumns_map: [ OK ] 0.37 sec. 2026-10-30 09:58:37 02581_share_big_sets_between_mutation_tasks_with_storage_set: [ OK ] 1.83 sec. 2026-10-30 09:58:37 02551_obfuscator_keywords: [ OK ] 2.54 sec. 2026-10-30 09:58:38 02536_date_from_number_inference_fix: [ OK ] 0.32 sec. 2026-10-30 09:58:38 01249_flush_interactive: [ OK ] 11.90 sec. 2026-10-30 09:58:38 00700_decimal_casts: [ OK ] 0.82 sec. 2026-10-30 09:58:39 01560_DateTime_and_DateTime64_comparision: [ OK ] 0.27 sec. 2026-10-30 09:58:39 02422_read_numbers_as_strings: [ OK ] 0.27 sec. 2026-10-30 09:58:39 02212_h3_get_pentagon_indexes: [ OK ] 0.42 sec. 2026-10-30 09:58:40 02784_disable_async_with_dedup_correctly: [ OK ] 3.78 sec. 2026-10-30 09:58:40 00821_distributed_storage_with_join_on: [ OK ] 0.37 sec. 2026-10-30 09:58:40 03164_adapting_parquet_reader_output_size: [ OK ] 1.12 sec. 2026-10-30 09:58:41 00090_union_race_conditions_1: [ OK ] 9.36 sec. 2026-10-30 09:58:41 03069_analyzer_with_alias_in_array_join: [ OK ] 0.27 sec. 2026-10-30 09:58:41 01921_test_progress_bar: [ OK ] 0.67 sec. 2026-10-30 09:58:41 01085_extract_all_empty: [ OK ] 0.32 sec. 2026-10-30 09:58:43 02381_compress_marks_and_primary_key: [ OK ] 1.88 sec. 2026-10-30 09:58:44 00223_shard_distributed_aggregation_memory_efficient: [ OK ] 2.68 sec. 2026-10-30 09:58:44 02933_compare_with_bool_as_string: [ OK ] 0.27 sec. 2026-10-30 09:58:44 03208_array_of_json_read_subcolumns_2_compact_merge_tree: [ SKIPPED ] 0.00 sec. 2026-10-30 09:58:44 Reason: not running for current build 2026-10-30 09:58:44 02480_client_option_print_num_processed_rows: [ OK ] 3.48 sec. 2026-10-30 09:58:44 01926_bin_unbin: [ OK ] 0.37 sec. 2026-10-30 09:58:44 02347_rank_corr_nan: [ OK ] 0.27 sec. 2026-10-30 09:58:44 01353_topk_enum: [ OK ] 0.32 sec. 2026-10-30 09:58:45 01817_storage_buffer_parameters: [ OK ] 0.32 sec. 2026-10-30 09:58:46 01079_bad_alters_zookeeper_long: [ OK ] 9.05 sec. 2026-10-30 09:58:47 02949_parallel_replicas_in_subquery: [ OK ] 0.42 sec. 2026-10-30 09:58:48 02841_parallel_replicas_summary: [ OK ] 3.23 sec. 2026-10-30 09:58:48 03164_analyzer_validate_tree_size: [ OK ] 0.37 sec. 2026-10-30 09:58:49 00996_neighbor: [ OK ] 0.37 sec. 2026-10-30 09:58:49 02883_read_in_reverse_order_virtual_column: [ OK ] 0.62 sec. 2026-10-30 09:58:50 02946_literal_alias_misclassification: [ OK ] 0.32 sec. 2026-10-30 09:58:50 00650_csv_with_specified_quote_rule: [ OK ] 6.34 sec. 2026-10-30 09:58:50 03203_system_numbers_limit_and_offset_complex: [ OK ] 0.32 sec. 2026-10-30 09:58:51 01273_lc_fixed_string_field: [ OK ] 0.37 sec. 2026-10-30 09:58:51 00422_hash_function_constexpr: [ OK ] 0.32 sec. 2026-10-30 09:58:52 02357_query_cancellation_race: [ OK ] 8.09 sec. 2026-10-30 09:58:52 03063_analyzer_multi_join_wrong_table_specifier: [ OK ] 0.32 sec. 2026-10-30 09:58:53 01610_client_spawn_editor: [ OK ] 0.27 sec. 2026-10-30 09:58:53 02884_duplicate_index_name: [ OK ] 0.27 sec. 2026-10-30 09:58:53 02718_parquet_metadata_format: [ OK ] 3.43 sec. 2026-10-30 09:58:53 00191_aggregating_merge_tree_and_final: [ OK ] 0.37 sec. 2026-10-30 09:58:53 01651_lc_insert_tiny_log_3: [ OK ] 6.80 sec. 2026-10-30 09:58:54 01511_different_expression_with_same_alias: [ OK ] 0.32 sec. 2026-10-30 09:58:54 01914_ubsan_quantile_timing: [ OK ] 0.32 sec. 2026-10-30 09:58:54 03039_dynamic_aggregating_merge_tree: [ OK ] 15.32 sec. 2026-10-30 09:58:54 01666_lcm_ubsan: [ OK ] 0.47 sec. 2026-10-30 09:58:55 01084_defaults_on_aliases: [ OK ] 0.37 sec. 2026-10-30 09:58:55 00165_transform_non_const_default: [ OK ] 0.32 sec. 2026-10-30 09:58:55 03276_functions_to_subcolumns_lc: [ OK ] 0.32 sec. 2026-10-30 09:58:56 01144_multiword_data_types: [ OK ] 0.32 sec. 2026-10-30 09:58:56 00503_cast_const_nullable: [ OK ] 0.27 sec. 2026-10-30 09:58:56 02816_check_projection_metadata: [ OK ] 0.32 sec. 2026-10-30 09:58:57 01518_nullable_aggregate_states2: [ OK ] 3.58 sec. 2026-10-30 09:58:57 01080_window_view_inner_table_memory_hop: [ OK ] 3.53 sec. 2026-10-30 09:58:58 02560_vertical_merge_memory_usage: [ OK ] 0.97 sec. 2026-10-30 09:58:58 01490_nullable_string_to_enum: [ OK ] 0.37 sec. 2026-10-30 09:58:58 03039_unknown_identifier_window_function: [ OK ] 0.32 sec. 2026-10-30 09:58:58 01622_constraints_where_optimization: [ OK ] 0.32 sec. 2026-10-30 09:58:58 00901_joint_entropy: [ OK ] 0.32 sec. 2026-10-30 09:58:59 02872_null_as_default_nested: [ OK ] 7.54 sec. 2026-10-30 09:58:59 00932_array_intersect_bug: [ OK ] 0.37 sec. 2026-10-30 09:59:00 00612_pk_in_tuple_perf: [ OK ] 3.93 sec. 2026-10-30 09:59:01 02013_bloom_filter_hasAll: [ OK ] 0.42 sec. 2026-10-30 09:59:02 03148_async_queries_in_query_log_errors: [ OK ] 3.63 sec. 2026-10-30 09:59:02 02718_cli_dashed_options_parsing: [ OK ] 4.18 sec. 2026-10-30 09:59:02 02577_analyzer_array_join_calc_twice: [ OK ] 0.27 sec. 2026-10-30 09:59:03 03013_ignore_drop_queries_probability: [ OK ] 0.37 sec. 2026-10-30 09:59:03 02423_ddl_for_opentelemetry: [ OK ] 8.99 sec. 2026-10-30 09:59:03 02515_aggregate_functions_statistics: [ OK ] 0.52 sec. 2026-10-30 09:59:03 02716_int256_arrayfunc: [ OK ] 0.32 sec. 2026-10-30 09:59:03 01787_map_remote: [ OK ] 0.32 sec. 2026-10-30 09:59:03 02366_kql_func_dynamic: [ OK ] 0.77 sec. 2026-10-30 09:59:04 01780_column_sparse_pk: [ OK ] 0.42 sec. 2026-10-30 09:59:04 02461_prewhere_row_level_policy_lightweight_delete: [ OK ] 0.97 sec. 2026-10-30 09:59:04 00939_limit_by_offset: [ OK ] 0.32 sec. 2026-10-30 09:59:05 02122_parallel_formatting_JSONEachRow: [ OK ] 4.03 sec. 2026-10-30 09:59:05 02205_map_populate_series_non_const: [ OK ] 0.72 sec. 2026-10-30 09:59:05 00566_enum_min_max: [ OK ] 0.32 sec. 2026-10-30 09:59:05 02178_column_function_insert_from: [ OK ] 0.37 sec. 2026-10-30 09:59:06 02315_readonly_create_function: [ OK ] 2.18 sec. 2026-10-30 09:59:06 02486_truncate_and_unexpected_parts: [ OK ] 0.92 sec. 2026-10-30 09:59:07 02985_if_over_big_int_decimal: [ OK ] 0.37 sec. 2026-10-30 09:59:07 00553_buff_exists_materlized_column: [ OK ] 0.37 sec. 2026-10-30 09:59:07 02135_local_create_db: [ OK ] 2.37 sec. 2026-10-30 09:59:07 03148_asof_join_ddb_subquery: [ OK ] 0.32 sec. 2026-10-30 09:59:07 02970_visible_width_behavior: [ OK ] 0.32 sec. 2026-10-30 09:59:08 02242_throw_if_constant_argument: [ OK ] 0.32 sec. 2026-10-30 09:59:08 03037_union_view: [ OK ] 0.32 sec. 2026-10-30 09:59:08 01502_jemalloc_percpu_arena: [ SKIPPED ] 0.00 sec. 2026-10-30 09:59:08 Reason: not running for current build 2026-10-30 09:59:08 03641_analyzer_issue_85834: [ OK ] 0.32 sec. 2026-10-30 09:59:09 02813_func_now_and_alias: [ OK ] 0.32 sec. 2026-10-30 09:59:09 02591_bson_long_tuple: [ OK ] 0.27 sec. 2026-10-30 09:59:09 02815_range_dict_no_direct_join: [ OK ] 0.32 sec. 2026-10-30 09:59:10 02898_parallel_replicas_custom_key_final: [ OK ] 0.37 sec. 2026-10-30 09:59:10 01710_projection_external_aggregate: [ OK ] 0.37 sec. 2026-10-30 09:59:10 00395_nullable: [ OK ] 2.48 sec. 2026-10-30 09:59:10 01118_is_constant: [ OK ] 0.32 sec. 2026-10-30 09:59:11 03001_data_version_column: [ OK ] 0.32 sec. 2026-10-30 09:59:11 02790_async_queries_in_query_log: [ OK ] 7.44 sec. 2026-10-30 09:59:11 00700_decimal_math: [ OK ] 0.42 sec. 2026-10-30 09:59:11 02487_create_index_normalize_functions: [ OK ] 0.37 sec. 2026-10-30 09:59:11 03167_fancy_quotes_off_by_one: [ OK ] 0.27 sec. 2026-10-30 09:59:12 02150_replace_regexp_all_empty_match: [ OK ] 0.27 sec. 2026-10-30 09:59:12 03167_base64_url_functions_sh: [ OK ] 49.37 sec. 2026-10-30 09:59:13 00989_parallel_parts_loading: [ OK ] 1.62 sec. 2026-10-30 09:59:13 01774_tuple_null_in: [ OK ] 0.27 sec. 2026-10-30 09:59:14 03246_skipping_index_70108: [ OK ] 2.28 sec. 2026-10-30 09:59:14 02841_join_filter_set_sparse: [ OK ] 0.42 sec. 2026-10-30 09:59:14 02918_multif_for_nullable: [ OK ] 3.02 sec. 2026-10-30 09:59:15 01011_test_create_as_skip_indices: [ OK ] 0.32 sec. 2026-10-30 09:59:15 00593_union_all_assert_columns_removed: [ OK ] 0.32 sec. 2026-10-30 09:59:16 01388_clear_all_columns: [ OK ] 0.57 sec. 2026-10-30 09:59:16 00900_orc_arrow_parquet_maps: [ OK ] 6.04 sec. 2026-10-30 09:59:16 00490_special_line_separators_and_characters_outside_of_bmp: [ OK ] 0.32 sec. 2026-10-30 09:59:16 02229_client_stop_multiquery_in_SIGINT: [ OK ] 9.40 sec. 2026-10-30 09:59:16 02931_alter_materialized_view_query_inconsistent: [ OK ] 0.37 sec. 2026-10-30 09:59:16 01345_array_join_LittleMaverick: [ OK ] 0.32 sec. 2026-10-30 09:59:17 02788_current_schemas_function: [ OK ] 0.37 sec. 2026-10-30 09:59:17 02126_fix_filelog: [ OK ] 3.38 sec. 2026-10-30 09:59:17 00818_alias_bug_4110: [ OK ] 0.42 sec. 2026-10-30 09:59:17 01822_short_circuit: [ OK ] 0.77 sec. 2026-10-30 09:59:17 01014_count_of_merges_metrics: [ OK ] 0.32 sec. 2026-10-30 09:59:17 00465_nullable_default: [ OK ] 0.32 sec. 2026-10-30 09:59:18 02868_select_support_from_keywords: [ OK ] 0.32 sec. 2026-10-30 09:59:18 01065_if_not_finite: [ OK ] 0.32 sec. 2026-10-30 09:59:18 02863_mutation_where_in_set_result_cache_pipeline_stuck_bug: [ OK ] 0.37 sec. 2026-10-30 09:59:18 00098_g_union_all: [ OK ] 0.27 sec. 2026-10-30 09:59:19 01542_collate_in_array: [ OK ] 0.37 sec. 2026-10-30 09:59:19 00956_http_prepared_statements: [ OK ] 1.98 sec. 2026-10-30 09:59:20 02668_parse_datetime_in_joda_syntax: [ OK ] 0.87 sec. 2026-10-30 09:59:21 00719_insert_block_without_column: [ OK ] 3.08 sec. 2026-10-30 09:59:21 02125_lz4_compression_bug_JSONCompactEachRow: [ OK ] 6.74 sec. 2026-10-30 09:59:21 01621_summap_check_types: [ OK ] 0.37 sec. 2026-10-30 09:59:21 02995_bad_formatting_union_intersect: [ OK ] 0.32 sec. 2026-10-30 09:59:21 01658_values_ubsan: [ OK ] 0.32 sec. 2026-10-30 09:59:22 00988_parallel_parts_removal: [ OK ] 2.88 sec. 2026-10-30 09:59:22 02191_parse_date_time_best_effort_more_cases: [ OK ] 0.32 sec. 2026-10-30 09:59:22 00022_func_higher_order_and_constants: [ OK ] 0.27 sec. 2026-10-30 09:59:22 02935_format_with_arbitrary_types: [ OK ] 0.57 sec. 2026-10-30 09:59:22 01710_projection_array_join: [ OK ] 0.32 sec. 2026-10-30 09:59:23 02872_prewhere_filter: [ OK ] 0.32 sec. 2026-10-30 09:59:23 02014_map_different_keys: [ OK ] 0.42 sec. 2026-10-30 09:59:24 01508_query_obfuscator: [ OK ] 2.47 sec. 2026-10-30 09:59:24 01077_mutations_index_consistency: [ OK ] 4.53 sec. 2026-10-30 09:59:26 02203_shebang: [ OK ] 2.12 sec. 2026-10-30 09:59:26 02932_kill_query_sleep: [ OK ] 4.13 sec. 2026-10-30 09:59:26 03142_skip_ANSI_in_UTF8_compute_width: [ OK ] 0.32 sec. 2026-10-30 09:59:27 02552_client_format_settings: [ OK ] 0.27 sec. 2026-10-30 09:59:27 01662_test_toDayOfMonth_mysql_compatibility: [ OK ] 0.32 sec. 2026-10-30 09:59:27 02972_to_string_nullable_timezone: [ OK ] 0.32 sec. 2026-10-30 09:59:28 02764_csv_trim_whitespaces: [ OK ] 29.56 sec. 2026-10-30 09:59:30 00387_use_client_time_zone: [ OK ] 2.07 sec. 2026-10-30 09:59:30 03203_variant_convert_field_to_type_bug: [ OK ] 0.32 sec. 2026-10-30 09:59:31 01947_mv_subquery: [ OK ] 0.77 sec. 2026-10-30 09:59:31 03203_client_benchmark_options: [ OK ] 7.64 sec. 2026-10-30 09:59:31 01280_null_in: [ OK ] 0.32 sec. 2026-10-30 09:59:32 03040_dynamic_type_alters_1_memory: [ OK ] 0.57 sec. 2026-10-30 09:59:32 01476_right_full_join_switch: [ OK ] 0.52 sec. 2026-10-30 09:59:32 00653_verification_monotonic_data_load: [ OK ] 15.51 sec. 2026-10-30 09:59:32 01710_projection_aggregate_functions_null_for_empty: [ OK ] 0.32 sec. 2026-10-30 09:59:33 01358_constexpr_constraint: [ OK ] 0.27 sec. 2026-10-30 09:59:33 02041_test_fuzzy_alter: [ OK ] 0.32 sec. 2026-10-30 09:59:33 01103_check_cpu_instructions_at_startup: [ SKIPPED ] 0.00 sec. 2026-10-30 09:59:33 Reason: not running for current build 2026-10-30 09:59:33 01471_with_format: [ OK ] 0.27 sec. 2026-10-30 09:59:33 02845_domain_rfc_support_ipv6: [ OK ] 0.37 sec. 2026-10-30 09:59:33 02047_log_family_data_file_sizes: [ OK ] 7.14 sec. 2026-10-30 09:59:33 02570_fallback_from_async_insert: [ OK ] 8.99 sec. 2026-10-30 09:59:33 01925_json_as_string_data_in_square_brackets: [ OK ] 0.27 sec. 2026-10-30 09:59:34 01561_aggregate_functions_of_key_with_join: [ OK ] 0.27 sec. 2026-10-30 09:59:34 00591_columns_removal_union_all: [ OK ] 0.37 sec. 2026-10-30 09:59:34 01831_max_streams: [ OK ] 0.32 sec. 2026-10-30 09:59:34 00135_duplicate_group_by_keys_segfault: [ OK ] 0.32 sec. 2026-10-30 09:59:34 01825_type_json_ghdata: [ OK ] 5.63 sec. 2026-10-30 09:59:34 02052_last_granula_adjust_logical_error: [ OK ] 0.62 sec. 2026-10-30 09:59:34 01050_engine_join_crash: [ OK ] 0.47 sec. 2026-10-30 09:59:34 00538_datediff_plural_units: [ OK ] 0.32 sec. 2026-10-30 09:59:34 01113_local_dictionary_type_conversion: [ OK ] 0.32 sec. 2026-10-30 09:59:35 01623_byte_size_const: [ OK ] 0.27 sec. 2026-10-30 09:59:35 02815_first_line: [ OK ] 0.32 sec. 2026-10-30 09:59:35 02433_default_expression_operator_in: [ OK ] 0.42 sec. 2026-10-30 09:59:35 00059_shard_global_in: [ OK ] 0.27 sec. 2026-10-30 09:59:35 02165_h3_edge_length_km: [ OK ] 0.32 sec. 2026-10-30 09:59:35 01302_polygons_distance: [ OK ] 0.32 sec. 2026-10-30 09:59:35 01277_fromUnixTimestamp64: [ OK ] 0.42 sec. 2026-10-30 09:59:35 02176_dict_get_has_implicit_key_cast: [ OK ] 0.52 sec. 2026-10-30 09:59:36 03237_get_subcolumn_low_cardinality_column: [ OK ] 0.27 sec. 2026-10-30 09:59:36 03199_merge_filters_bug: [ OK ] 0.37 sec. 2026-10-30 09:59:36 02381_join_dup_columns_in_plan: [ OK ] 0.42 sec. 2026-10-30 09:59:36 02269_to_start_of_interval_overflow: [ OK ] 0.32 sec. 2026-10-30 09:59:36 01869_reinterpret_as_fixed_string_uuid: [ OK ] 0.32 sec. 2026-10-30 09:59:37 01825_type_json_in_array: [ OK ] 0.42 sec. 2026-10-30 09:59:37 02899_indexing_by_space_filling_curves: [ OK ] 0.52 sec. 2026-10-30 09:59:37 01421_assert_in_in: [ OK ] 0.32 sec. 2026-10-30 09:59:37 01621_sort_after_join_pipeline_stuck: [ OK ] 0.37 sec. 2026-10-30 09:59:37 01525_select_with_offset_fetch_clause: [ OK ] 0.32 sec. 2026-10-30 09:59:38 02366_window_function_order_by: [ OK ] 0.32 sec. 2026-10-30 09:59:38 01353_low_cardinality_join_types: [ OK ] 0.47 sec. 2026-10-30 09:59:38 02567_native_type_conversions: [ OK ] 2.88 sec. 2026-10-30 09:59:38 03142_untuple_crash: [ OK ] 0.27 sec. 2026-10-30 09:59:38 02514_tsv_zero_started_number: [ OK ] 0.27 sec. 2026-10-30 09:59:38 00975_recursive_materialized_view: [ OK ] 0.32 sec. 2026-10-30 09:59:39 01894_jit_aggregation_function_max_long: [ OK ] 0.98 sec. 2026-10-30 09:59:39 03115_alias_exists_column: [ OK ] 0.27 sec. 2026-10-30 09:59:39 03199_unbin_buffer_overflow: [ OK ] 8.04 sec. 2026-10-30 09:59:39 02429_combinators_in_array_reduce: [ OK ] 0.32 sec. 2026-10-30 09:59:39 02993_lazy_index_loading: [ OK ] 1.32 sec. 2026-10-30 09:59:40 03215_view_with_recursive: [ OK ] 0.42 sec. 2026-10-30 09:59:40 02801_backup_native_copy: [ OK ] 5.23 sec. 2026-10-30 09:59:40 02982_dont_infer_exponent_floats: [ OK ] 0.32 sec. 2026-10-30 09:59:40 01664_decimal_ubsan: [ OK ] 0.27 sec. 2026-10-30 09:59:40 02684_bson: [ OK ] 0.32 sec. 2026-10-30 09:59:40 02888_obsolete_settings: [ OK ] 0.27 sec. 2026-10-30 09:59:40 01390_remove_injective_in_uniq: [ OK ] 0.37 sec. 2026-10-30 09:59:40 02575_merge_prewhere_materialized: [ OK ] 0.37 sec. 2026-10-30 09:59:40 02017_columns_with_dot: [ OK ] 0.37 sec. 2026-10-30 09:59:40 01116_cross_count_asterisks: [ OK ] 0.32 sec. 2026-10-30 09:59:41 02113_format_row: [ OK ] 0.27 sec. 2026-10-30 09:59:41 03575_modify_column_null_to_default_cross_type: [ OK ] 0.47 sec. 2026-10-30 09:59:41 01247_least_greatest_filimonov: [ OK ] 0.27 sec. 2026-10-30 09:59:41 01518_nullable_aggregate_states1: [ OK ] 0.47 sec. 2026-10-30 09:59:42 02243_in_ip_address: [ OK ] 0.32 sec. 2026-10-30 09:59:42 02378_part_log_profile_events: [ OK ] 0.92 sec. 2026-10-30 09:59:42 02521_analyzer_array_join_crash: [ OK ] 0.32 sec. 2026-10-30 09:59:42 02381_arrow_dict_to_lc: [ OK ] 2.18 sec. 2026-10-30 09:59:43 01646_rewrite_sum_if: [ OK ] 0.48 sec. 2026-10-30 09:59:43 01825_type_json_8: [ OK ] 4.13 sec. 2026-10-30 09:59:43 00902_entropy: [ OK ] 0.37 sec. 2026-10-30 09:59:43 02114_bool_type: [ OK ] 0.37 sec. 2026-10-30 09:59:43 01412_group_array_moving_shard: [ OK ] 0.52 sec. 2026-10-30 09:59:43 03036_dynamic_read_shared_subcolumns_memory: [ SKIPPED ] 0.00 sec. 2026-10-30 09:59:43 Reason: not running for current build 2026-10-30 09:59:43 00109_shard_totals_after_having: [ OK ] 1.32 sec. 2026-10-30 09:59:44 00715_bounding_ratio_merge_empty: [ OK ] 0.32 sec. 2026-10-30 09:59:44 03261_test_merge_parquet_bloom_filter_minmax_stats: [ SKIPPED ] 0.00 sec. 2026-10-30 09:59:44 Reason: not running for current build 2026-10-30 09:59:45 01171_mv_select_insert_isolation_long: [ OK ] 120.52 sec. 2026-10-30 09:59:45 01676_range_hashed_dictionary: [ OK ] 0.57 sec. 2026-10-30 09:59:45 02703_jit_external_aggregation: [ SKIPPED ] 0.00 sec. 2026-10-30 09:59:45 Reason: not running for current build 2026-10-30 09:59:46 00411_merge_tree_where_const_in_set: [ OK ] 0.37 sec. 2026-10-30 09:59:46 02126_url_auth: [ OK ] 2.48 sec. 2026-10-30 09:59:46 00224_shard_distributed_aggregation_memory_efficient_and_overflows: [ OK ] 0.47 sec. 2026-10-30 09:59:46 03155_test_move_to_prewhere: [ OK ] 2.83 sec. 2026-10-30 09:59:46 01950_kill_large_group_by_query: [ OK ] 2.93 sec. 2026-10-30 09:59:46 02861_filter_pushdown_const_bug: [ OK ] 0.37 sec. 2026-10-30 09:59:46 02810_async_insert_dedup_replicated_collapsing: [ OK ] 13.25 sec. 2026-10-30 09:59:47 02221_system_zookeeper_unrestricted_like: [ OK ] 4.18 sec. 2026-10-30 09:59:47 03096_largest_triangle_3b_crash: [ OK ] 0.27 sec. 2026-10-30 09:59:47 00122_join_with_subquery_with_subquery: [ OK ] 0.32 sec. 2026-10-30 09:59:47 00878_join_unexpected_results: [ OK ] 0.52 sec. 2026-10-30 09:59:47 00605_intersections_aggregate_functions: [ OK ] 0.32 sec. 2026-10-30 09:59:47 02260_alter_compact_part_drop_nested_column: [ OK ] 0.42 sec. 2026-10-30 09:59:47 02963_test_flexible_disk_configuration: [ OK ] 0.77 sec. 2026-10-30 09:59:47 01547_query_log_current_database: [ OK ] 0.52 sec. 2026-10-30 09:59:48 03002_analyzer_prewhere: [ OK ] 0.37 sec. 2026-10-30 09:59:48 00369_int_div_of_float: [ OK ] 0.32 sec. 2026-10-30 09:59:48 01387_clear_column_default_depends: [ OK ] 0.47 sec. 2026-10-30 09:59:48 02502_analyzer_insert_select_crash_fix: [ OK ] 0.32 sec. 2026-10-30 09:59:48 00552_logical_functions_simple: [ OK ] 0.37 sec. 2026-10-30 09:59:48 00753_quantile_format: [ OK ] 0.42 sec. 2026-10-30 09:59:49 02874_json_merge_patch_function_test: [ OK ] 0.42 sec. 2026-10-30 09:59:49 01848_partition_value_column: [ OK ] 0.37 sec. 2026-10-30 09:59:49 01010_partial_merge_join_const_and_lc: [ OK ] 0.37 sec. 2026-10-30 09:59:49 02497_having_without_actual_aggregation_bug: [ OK ] 0.32 sec. 2026-10-30 09:59:49 02786_parquet_big_integer_compatibility: [ OK ] 2.47 sec. 2026-10-30 09:59:50 02968_url_args: [ OK ] 0.37 sec. 2026-10-30 09:59:50 01273_arrow_decimal: [ OK ] 3.43 sec. 2026-10-30 09:59:50 02560_regexp_denial_of_service: [ OK ] 0.77 sec. 2026-10-30 09:59:50 03198_settings_in_csv_tsv_schema_cache: [ OK ] 2.88 sec. 2026-10-30 09:59:50 02496_remove_redundant_sorting_analyzer: [ OK ] 11.45 sec. 2026-10-30 09:59:51 01926_union_all_schmak: [ OK ] 0.28 sec. 2026-10-30 09:59:51 00910_zookeeper_test_alter_compression_codecs_long: [ OK ] 0.57 sec. 2026-10-30 09:59:52 02381_analyzer_join_final: [ OK ] 0.32 sec. 2026-10-30 09:59:52 02206_format_override: [ OK ] 3.03 sec. 2026-10-30 09:59:52 02366_kql_summarize: [ OK ] 0.57 sec. 2026-10-30 09:59:52 00936_substring_utf8_non_const: [ OK ] 3.23 sec. 2026-10-30 09:59:52 01376_array_fill_empty: [ OK ] 0.27 sec. 2026-10-30 09:59:53 01232_untuple: [ OK ] 0.32 sec. 2026-10-30 09:59:53 01107_join_right_table_totals: [ OK ] 0.37 sec. 2026-10-30 09:59:53 02372_analyzer_join: [ OK ] 2.63 sec. 2026-10-30 09:59:53 03065_analyzer_cross_join_and_array_join: [ OK ] 0.27 sec. 2026-10-30 09:59:54 00700_decimal_aggregates: [ OK ] 0.62 sec. 2026-10-30 09:59:54 01202_array_auc_special: [ OK ] 0.37 sec. 2026-10-30 09:59:54 02428_combinators_with_over_statement: [ OK ] 0.32 sec. 2026-10-30 09:59:54 00679_uuid_in_key: [ OK ] 0.32 sec. 2026-10-30 09:59:54 02359_send_logs_source_regexp: [ OK ] 2.02 sec. 2026-10-30 09:59:54 03230_anyHeavy_merge: [ OK ] 0.27 sec. 2026-10-30 09:59:55 02010_array_index_bad_cast: [ OK ] 0.27 sec. 2026-10-30 09:59:55 00804_test_custom_compression_codecs: [ OK ] 0.72 sec. 2026-10-30 09:59:56 02494_zero_copy_and_projection_and_mutation_work_together: [ OK ] 5.53 sec. 2026-10-30 09:59:56 00534_functions_bad_arguments12: [ OK ] 5.38 sec. 2026-10-30 09:59:56 03161_decimal_binary_math: [ OK ] 0.47 sec. 2026-10-30 09:59:56 03002_filter_skip_virtual_columns_with_non_deterministic_functions: [ OK ] 1.87 sec. 2026-10-30 09:59:56 00300_csv: [ OK ] 0.27 sec. 2026-10-30 09:59:56 03032_variant_bool_number_not_suspicious: [ OK ] 0.27 sec. 2026-10-30 09:59:56 01715_table_function_view_fix: [ OK ] 0.27 sec. 2026-10-30 09:59:56 01630_simple_aggregate_function_in_summing_merge_tree: [ OK ] 0.37 sec. 2026-10-30 09:59:56 00181_aggregate_functions_statistics_stable: [ OK ] 0.37 sec. 2026-10-30 09:59:57 02915_analyzer_fuzz_2: [ OK ] 0.37 sec. 2026-10-30 09:59:57 03024_total_rows_approx_is_set_for_system_zeros_and_generate_random: [ OK ] 0.32 sec. 2026-10-30 09:59:57 01508_format_regexp_raw: [ OK ] 2.47 sec. 2026-10-30 09:59:57 00804_rollup_with_having: [ OK ] 0.32 sec. 2026-10-30 09:59:57 01012_select_limit_x_0: [ OK ] 0.27 sec. 2026-10-30 09:59:57 02366_kql_native_interval_format: [ OK ] 0.32 sec. 2026-10-30 09:59:57 02720_row_policy_column_with_dots: [ OK ] 0.32 sec. 2026-10-30 09:59:57 01851_clear_column_referenced_by_mv: [ OK ] 0.32 sec. 2026-10-30 09:59:57 00484_preferred_max_column_in_block_size_bytes: [ OK ] 0.67 sec. 2026-10-30 09:59:58 03131_rewrite_sum_if_nullable: [ OK ] 0.42 sec. 2026-10-30 09:59:58 02366_kql_func_math: [ OK ] 0.37 sec. 2026-10-30 09:59:58 00700_to_decimal_or_something: [ OK ] 0.67 sec. 2026-10-30 09:59:58 02353_translate: [ OK ] 0.37 sec. 2026-10-30 09:59:58 00155_long_merges: [ OK ] 121.98 sec. 2026-10-30 09:59:59 02975_intdiv_with_decimal: [ OK ] 0.57 sec. 2026-10-30 09:59:59 01280_min_map_max_map: [ OK ] 0.47 sec. 2026-10-30 09:59:59 01018_ddl_dictionaries_special: [ OK ] 0.52 sec. 2026-10-30 09:59:59 02354_vector_search_detach_attach: [ OK ] 0.32 sec. 2026-10-30 09:59:59 01010_pm_join_all_join_bug: [ OK ] 0.32 sec. 2026-10-30 09:59:59 00356_analyze_aggregations_and_union_all: [ OK ] 0.27 sec. 2026-10-30 09:59:59 02047_log_family_complex_structs_data_file_dumps: [ OK ] 7.13 sec. 2026-10-30 10:00:00 00851_http_insert_json_defaults: [ OK ] 2.88 sec. 2026-10-30 10:00:00 00084_summing_merge_tree: [ OK ] 0.42 sec. 2026-10-30 10:00:00 02251_alter_enum_nested_struct: [ OK ] 0.37 sec. 2026-10-30 10:00:00 00558_aggregate_merge_totals_with_arenas: [ OK ] 0.27 sec. 2026-10-30 10:00:00 00045_sorting_by_fixed_string_descending: [ OK ] 0.27 sec. 2026-10-30 10:00:00 01616_untuple_access_field: [ OK ] 0.27 sec. 2026-10-30 10:00:00 01890_jit_aggregation_function_sum_long: [ OK ] 0.82 sec. 2026-10-30 10:00:01 01020_having_without_group_by: [ OK ] 0.27 sec. 2026-10-30 10:00:01 02677_grace_hash_limit_race: [ OK ] 0.37 sec. 2026-10-30 10:00:01 02267_type_inference_for_insert_into_function_null: [ OK ] 0.32 sec. 2026-10-30 10:00:01 00938_test_retention_function: [ OK ] 0.32 sec. 2026-10-30 10:00:01 01035_avg: [ OK ] 2.47 sec. 2026-10-30 10:00:01 02594_msgpack_more_types: [ OK ] 2.38 sec. 2026-10-30 10:00:02 03289_explain_syntax_statistics: [ OK ] 0.27 sec. 2026-10-30 10:00:02 02354_parse_timedelta: [ OK ] 0.62 sec. 2026-10-30 10:00:02 00034_fixed_string_to_number: [ OK ] 0.27 sec. 2026-10-30 10:00:02 02136_scalar_progress: [ OK ] 1.82 sec. 2026-10-30 10:00:02 01395_limit_more_cases: [ OK ] 15.45 sec. 2026-10-30 10:00:02 00075_shard_formatting_negate_of_negative_literal: [ OK ] 0.27 sec. 2026-10-30 10:00:02 01881_join_on_conditions_merge: [ OK ] 0.82 sec. 2026-10-30 10:00:02 03144_fuzz_quoted_type_name: [ OK ] 0.32 sec. 2026-10-30 10:00:03 02864_statistics_predicates: [ OK ] 1.47 sec. 2026-10-30 10:00:03 00318_pk_tuple_order: [ OK ] 0.57 sec. 2026-10-30 10:00:03 00116_storage_set: [ OK ] 0.42 sec. 2026-10-30 10:00:03 00738_nested_merge_multidimensional_array: [ OK ] 0.32 sec. 2026-10-30 10:00:03 01050_group_array_sample: [ OK ] 0.27 sec. 2026-10-30 10:00:03 02243_make_date32_mysql: [ OK ] 0.42 sec. 2026-10-30 10:00:03 00293_shard_max_subquery_depth: [ OK ] 0.37 sec. 2026-10-30 10:00:03 00942_mv_rename_table: [ OK ] 0.32 sec. 2026-10-30 10:00:03 03207_json_read_subcolumns_2_wide_merge_tree: [ SKIPPED ] 0.00 sec. 2026-10-30 10:00:03 Reason: not running for current build 2026-10-30 10:00:04 02477_age_date32: [ OK ] 0.47 sec. 2026-10-30 10:00:04 01780_range_msan: [ OK ] 0.32 sec. 2026-10-30 10:00:04 01651_map_functions: [ OK ] 0.73 sec. 2026-10-30 10:00:04 02360_send_logs_level_colors: [ OK ] 2.47 sec. 2026-10-30 10:00:05 01852_hints_enum_name: [ OK ] 2.07 sec. 2026-10-30 10:00:05 00715_fetch_merged_or_mutated_part_zookeeper: [ OK ] 7.04 sec. 2026-10-30 10:00:05 02457_morton_coding: [ OK ] 0.77 sec. 2026-10-30 10:00:05 02912_group_array_sample: [ OK ] 0.27 sec. 2026-10-30 10:00:05 02972_parallel_replicas_cte: [ OK ] 0.52 sec. 2026-10-30 10:00:05 00857_global_joinsavel_table_alias: [ OK ] 0.47 sec. 2026-10-30 10:00:05 00386_long_in_pk: [ OK ] 9.19 sec. 2026-10-30 10:00:05 01073_show_tables_not_like: [ OK ] 0.37 sec. 2026-10-30 10:00:05 00950_test_gorilla_codec: [ OK ] 0.37 sec. 2026-10-30 10:00:05 00055_join_two_numbers: [ OK ] 0.32 sec. 2026-10-30 10:00:06 02810_fix_remove_dedundant_distinct_view: [ OK ] 0.37 sec. 2026-10-30 10:00:06 01083_cross_to_inner_with_in_bug: [ OK ] 0.32 sec. 2026-10-30 10:00:06 01710_query_log_with_projection_info: [ OK ] 0.67 sec. 2026-10-30 10:00:06 01720_union_distinct_with_limit: [ OK ] 0.32 sec. 2026-10-30 10:00:06 01944_insert_partition_by: [ OK ] 0.47 sec. 2026-10-30 10:00:06 02995_index_3: [ SKIPPED ] 0.00 sec. 2026-10-30 10:00:06 Reason: not running for current build 2026-10-30 10:00:06 02990_format_not_precedence: [ OK ] 0.32 sec. 2026-10-30 10:00:07 02481_pk_analysis_with_enum_to_string: [ OK ] 0.57 sec. 2026-10-30 10:00:08 01399_http_request_headers: [ OK ] 1.98 sec. 2026-10-30 10:00:08 01866_view_persist_settings: [ OK ] 0.57 sec. 2026-10-30 10:00:08 00322_disable_checksumming: [ OK ] 1.77 sec. 2026-10-30 10:00:08 03207_json_read_subcolumns_1_wide_merge_tree: [ OK ] 2.43 sec. 2026-10-30 10:00:08 01514_parallel_formatting: [ OK ] 5.98 sec. 2026-10-30 10:00:08 01710_force_use_projection: [ OK ] 0.42 sec. 2026-10-30 10:00:08 01137_sample_final: [ OK ] 0.32 sec. 2026-10-30 10:00:08 01710_minmax_count_projection_modify_partition_key: [ OK ] 0.32 sec. 2026-10-30 10:00:08 03156_nullable_number_tips: [ OK ] 0.37 sec. 2026-10-30 10:00:09 02989_replicated_merge_tree_invalid_metadata_version: [ OK ] 0.47 sec. 2026-10-30 10:00:09 01272_totals_and_filter_bug: [ OK ] 0.37 sec. 2026-10-30 10:00:09 01281_sum_nullable: [ OK ] 0.32 sec. 2026-10-30 10:00:09 02800_transform_alter: [ OK ] 0.37 sec. 2026-10-30 10:00:09 00875_join_right_nulls: [ OK ] 0.47 sec. 2026-10-30 10:00:09 02910_bad_logs_level_in_local: [ OK ] 0.32 sec. 2026-10-30 10:00:10 00064_negate_bug: [ OK ] 0.27 sec. 2026-10-30 10:00:10 03003_database_filesystem_format_detection: [ OK ] 2.32 sec. 2026-10-30 10:00:10 02691_multiple_joins_backtick_identifiers: [ OK ] 0.37 sec. 2026-10-30 10:00:11 00443_optimize_final_vertical_merge: [ OK ] 7.34 sec. 2026-10-30 10:00:11 01384_bloom_filter_bad_arguments: [ OK ] 0.42 sec. 2026-10-30 10:00:11 02597_projection_materialize_and_replication: [ OK ] 1.37 sec. 2026-10-30 10:00:11 01681_hyperscan_debug_assertion: [ OK ] 2.17 sec. 2026-10-30 10:00:11 02972_insert_deduplication_token_hierarchical_inserts_views: [ OK ] 3.58 sec. 2026-10-30 10:00:12 01746_test_for_tupleElement_must_be_constant_issue: [ OK ] 0.57 sec. 2026-10-30 10:00:12 00003_reinterpret_as_string: [ OK ] 0.32 sec. 2026-10-30 10:00:12 02345_analyzer_subqueries: [ OK ] 0.37 sec. 2026-10-30 10:00:13 02313_cross_join_dup_col_names: [ OK ] 0.32 sec. 2026-10-30 10:00:13 02590_interserver_mode_client_info_initial_query_start_time: [ OK ] 7.69 sec. 2026-10-30 10:00:13 01300_group_by_other_keys_having: [ OK ] 1.57 sec. 2026-10-30 10:00:13 02122_parallel_formatting_JSONStrings: [ OK ] 4.18 sec. 2026-10-30 10:00:13 02421_json_decimals_as_strings: [ OK ] 0.27 sec. 2026-10-30 10:00:13 01282_system_parts_ttl_info: [ OK ] 0.37 sec. 2026-10-30 10:00:13 03199_fix_auc_tie_handling: [ OK ] 0.37 sec. 2026-10-30 10:00:13 01662_date_ubsan: [ OK ] 0.67 sec. 2026-10-30 10:00:14 00141_parse_timestamp_as_datetime: [ OK ] 0.32 sec. 2026-10-30 10:00:14 02935_ipv6_bit_operations: [ OK ] 0.27 sec. 2026-10-30 10:00:14 02875_parallel_replicas_cluster_all_replicas: [ OK ] 0.62 sec. 2026-10-30 10:00:14 01020_function_array_compact: [ OK ] 0.32 sec. 2026-10-30 10:00:14 02890_describe_table_options: [ OK ] 0.37 sec. 2026-10-30 10:00:14 01430_fix_any_rewrite_aliases: [ OK ] 0.27 sec. 2026-10-30 10:00:14 03144_invalid_filter: [ OK ] 0.37 sec. 2026-10-30 10:00:15 01615_two_args_function_index_fix: [ OK ] 0.32 sec. 2026-10-30 10:00:15 01940_totimezone_operator_monotonicity: [ OK ] 0.32 sec. 2026-10-30 10:00:16 03168_query_log_privileges_not_empty: [ OK ] 5.54 sec. 2026-10-30 10:00:16 02160_h3_hex_area_Km2: [ OK ] 0.32 sec. 2026-10-30 10:00:16 00372_cors_header: [ OK ] 1.92 sec. 2026-10-30 10:00:17 00999_join_on_expression: [ OK ] 0.42 sec. 2026-10-30 10:00:17 00574_empty_strings_deserialization: [ OK ] 3.58 sec. 2026-10-30 10:00:17 02266_protobuf_format_google_wrappers: [ OK ] 5.48 sec. 2026-10-30 10:00:17 01614_with_fill_with_limit: [ OK ] 0.32 sec. 2026-10-30 10:00:17 01600_encode_XML: [ OK ] 0.32 sec. 2026-10-30 10:00:17 01135_default_and_alter_zookeeper: [ OK ] 0.42 sec. 2026-10-30 10:00:17 02343_analyzer_column_transformers_strict: [ OK ] 0.32 sec. 2026-10-30 10:00:17 02681_comparsion_tuple_elimination_ast: [ OK ] 0.37 sec. 2026-10-30 10:00:18 02366_normalize_aggregate_function_types_and_states: [ OK ] 0.27 sec. 2026-10-30 10:00:18 01825_type_json_5: [ OK ] 0.37 sec. 2026-10-30 10:00:19 02915_lazy_loading_of_base_backups: [ OK ] 5.23 sec. 2026-10-30 10:00:19 01509_format_raw_blob: [ OK ] 2.78 sec. 2026-10-30 10:00:19 01866_datetime64_cmp_with_constant: [ OK ] 0.37 sec. 2026-10-30 10:00:19 01338_long_select_and_alter_zookeeper: [ OK ] 15.36 sec. 2026-10-30 10:00:20 01388_multi_if_optimization: [ OK ] 0.32 sec. 2026-10-30 10:00:20 02458_key_condition_not_like_prefix: [ OK ] 0.42 sec. 2026-10-30 10:00:20 01951_distributed_push_down_limit: [ OK ] 0.32 sec. 2026-10-30 10:00:20 01593_insert_settings: [ OK ] 0.37 sec. 2026-10-30 10:00:20 01558_ttest_scipy: [ OK ] 2.88 sec. 2026-10-30 10:00:20 01356_initialize_aggregation: [ OK ] 0.32 sec. 2026-10-30 10:00:20 01323_redundant_functions_in_order_by: [ OK ] 0.52 sec. 2026-10-30 10:00:20 01513_count_without_select_sequence_consistency_zookeeper_long: [ OK ] 0.49 sec. 2026-10-30 10:00:20 00157_aliases_and_lambda_formal_parameters: [ OK ] 0.32 sec. 2026-10-30 10:00:21 01343_min_bytes_to_use_mmap_io: [ OK ] 0.42 sec. 2026-10-30 10:00:21 01903_http_fields: [ OK ] 2.68 sec. 2026-10-30 10:00:21 02346_fulltext_index_bug47393: [ OK ] 0.32 sec. 2026-10-30 10:00:21 02882_primary_key_index_in_function_different_types: [ OK ] 0.32 sec. 2026-10-30 10:00:21 00854_multiple_join_asterisks: [ OK ] 0.32 sec. 2026-10-30 10:00:22 02296_nullable_arguments_in_array_filter: [ OK ] 0.32 sec. 2026-10-30 10:00:23 02246_is_secure_query_log: [ OK ] 5.08 sec. 2026-10-30 10:00:23 02454_set_parameters_formatting: [ OK ] 2.48 sec. 2026-10-30 10:00:23 02983_empty_map: [ OK ] 0.87 sec. 2026-10-30 10:00:24 02151_http_s_structure_set_eof: [ OK ] 3.53 sec. 2026-10-30 10:00:24 03041_dynamic_type_check_table: [ OK ] 8.79 sec. 2026-10-30 10:00:24 00228_shard_quantiles_deterministic_merge_overflow: [ OK ] 0.37 sec. 2026-10-30 10:00:24 01144_multiple_joins_rewriter_v2_and_lambdas: [ OK ] 0.37 sec. 2026-10-30 10:00:24 01085_datetime_arithmetic_preserve_timezone: [ OK ] 0.32 sec. 2026-10-30 10:00:24 03033_final_undefined_last_mark: [ OK ] 0.32 sec. 2026-10-30 10:00:25 03041_analyzer_gigachad_join: [ OK ] 0.32 sec. 2026-10-30 10:00:25 02430_initialize_aggregation_with_combinators: [ OK ] 0.27 sec. 2026-10-30 10:00:25 01054_random_printable_ascii_ubsan: [ OK ] 3.59 sec. 2026-10-30 10:00:25 00530_arrays_of_nothing: [ OK ] 0.27 sec. 2026-10-30 10:00:25 02991_count_rewrite_analyzer: [ OK ] 0.27 sec. 2026-10-30 10:00:25 03215_parallel_replicas_crash_after_refactoring: [ OK ] 0.37 sec. 2026-10-30 10:00:26 02815_join_algorithm_setting: [ OK ] 1.02 sec. 2026-10-30 10:00:26 02316_values_table_func_bug: [ OK ] 0.32 sec. 2026-10-30 10:00:26 00098_1_union_all: [ OK ] 0.37 sec. 2026-10-30 10:00:26 01554_row_number_after_cannot_read_all_data: [ OK ] 2.22 sec. 2026-10-30 10:00:26 00453_top_k: [ OK ] 0.32 sec. 2026-10-30 10:00:26 01522_validate_alter_default: [ OK ] 0.32 sec. 2026-10-30 10:00:26 00540_bad_data_types: [ OK ] 5.99 sec. 2026-10-30 10:00:26 00173_compare_date_time_with_constant_string: [ OK ] 0.57 sec. 2026-10-30 10:00:27 02721_url_cluster: [ OK ] 0.57 sec. 2026-10-30 10:00:27 02887_tuple_element_distributed: [ OK ] 0.32 sec. 2026-10-30 10:00:28 02270_errors_in_files: [ OK ] 4.63 sec. 2026-10-30 10:00:28 00215_primary_key_order_zookeeper_long: [ OK ] 0.37 sec. 2026-10-30 10:00:28 00825_http_header_query_id: [ OK ] 1.92 sec. 2026-10-30 10:00:28 01073_crlf_end_of_line: [ OK ] 0.32 sec. 2026-10-30 10:00:28 02013_json_function_null_column: [ OK ] 0.52 sec. 2026-10-30 10:00:28 02129_window_functions_disable_optimizations: [ OK ] 0.42 sec. 2026-10-30 10:00:28 02678_explain_pipeline_graph_with_projection: [ OK ] 0.37 sec. 2026-10-30 10:00:29 03210_dynamic_squashing: [ OK ] 0.77 sec. 2026-10-30 10:00:29 02242_make_date_mysql: [ OK ] 0.42 sec. 2026-10-30 10:00:29 01097_pre_limit: [ OK ] 0.27 sec. 2026-10-30 10:00:30 02875_parallel_replicas_remote: [ OK ] 0.92 sec. 2026-10-30 10:00:30 00236_replicated_drop_on_non_leader_zookeeper_long: [ OK ] 0.42 sec. 2026-10-30 10:00:31 00462_json_true_false_literals: [ OK ] 0.32 sec. 2026-10-30 10:00:31 01087_index_set_ubsan: [ OK ] 0.32 sec. 2026-10-30 10:00:31 02944_variant_as_common_type_analyzer: [ OK ] 0.47 sec. 2026-10-30 10:00:32 02579_parameterized_replace: [ OK ] 0.32 sec. 2026-10-30 10:00:32 03134_positional_arguments: [ OK ] 5.33 sec. 2026-10-30 10:00:32 02764_parallel_replicas_plain_merge_tree: [ OK ] 0.37 sec. 2026-10-30 10:00:32 01739_index_hint: [ OK ] 0.47 sec. 2026-10-30 10:00:32 02500_analyzer_storage_view_crash_fix: [ OK ] 0.32 sec. 2026-10-30 10:00:33 01942_dateTimeToSnowflake: [ OK ] 0.47 sec. 2026-10-30 10:00:33 01134_max_rows_to_group_by: [ OK ] 0.37 sec. 2026-10-30 10:00:33 01460_allow_dollar_and_number_in_identifier: [ OK ] 0.27 sec. 2026-10-30 10:00:33 01559_aggregate_null_for_empty_fix: [ OK ] 0.37 sec. 2026-10-30 10:00:34 00457_log_tinylog_stripelog_nullable: [ OK ] 0.47 sec. 2026-10-30 10:00:34 03291_json_big_structure_deserialization: [ OK ] 8.19 sec. 2026-10-30 10:00:34 00468_array_join_multiple_arrays_and_use_original_column: [ OK ] 0.57 sec. 2026-10-30 10:00:34 02002_sampling_and_unknown_column_bug: [ OK ] 0.32 sec. 2026-10-30 10:00:34 02815_logical_error_cannot_get_column_name_of_set: [ OK ] 0.32 sec. 2026-10-30 10:00:34 02187_test_final_and_limit_modifier: [ OK ] 0.32 sec. 2026-10-30 10:00:34 00853_join_with_nulls_crash: [ OK ] 0.37 sec. 2026-10-30 10:00:35 02551_ipv4_implicit_uint64: [ OK ] 0.27 sec. 2026-10-30 10:00:35 00061_merge_tree_alter: [ OK ] 0.57 sec. 2026-10-30 10:00:35 02179_degrees_radians: [ OK ] 0.37 sec. 2026-10-30 10:00:37 02968_mysql_prefer_column_name_to_alias: [ OK ] 1.82 sec. 2026-10-30 10:00:37 00900_long_parquet: [ OK ] 25.24 sec. 2026-10-30 10:00:37 00411_long_accurate_number_comparison_int1: [ OK ] 8.24 sec. 2026-10-30 10:00:37 01834_alias_columns_laziness_filimonov: [ OK ] 2.68 sec. 2026-10-30 10:00:37 00328_long_case_construction: [ OK ] 15.42 sec. 2026-10-30 10:00:37 02920_rename_column_of_skip_indices: [ OK ] 0.32 sec. 2026-10-30 10:00:37 01655_quarter_modificator_for_formatDateTime: [ OK ] 0.27 sec. 2026-10-30 10:00:37 03146_bug47862: [ OK ] 0.27 sec. 2026-10-30 10:00:37 00794_materialized_view_with_column_defaults: [ OK ] 0.32 sec. 2026-10-30 10:00:37 00464_array_element_out_of_range: [ OK ] 0.27 sec. 2026-10-30 10:00:37 03230_subcolumns_mv: [ OK ] 0.32 sec. 2026-10-30 10:00:37 01411_xor_itai_shirav: [ OK ] 0.27 sec. 2026-10-30 10:00:37 01379_with_fill_several_columns: [ OK ] 0.27 sec. 2026-10-30 10:00:38 00665_alter_nullable_string_to_nullable_uint8: [ OK ] 0.32 sec. 2026-10-30 10:00:38 00930_arrayIntersect: [ OK ] 0.42 sec. 2026-10-30 10:00:38 01492_array_join_crash_13829: [ OK ] 0.27 sec. 2026-10-30 10:00:38 00060_date_lut: [ OK ] 0.27 sec. 2026-10-30 10:00:38 02293_http_header_full_summary_without_progress: [ OK ] 2.83 sec. 2026-10-30 10:00:38 03199_queries_with_new_analyzer: [ OK ] 0.37 sec. 2026-10-30 10:00:38 00712_prewhere_with_alias: [ OK ] 0.42 sec. 2026-10-30 10:00:38 02916_distributed_skip_unavailable_shards: [ OK ] 0.32 sec. 2026-10-30 10:00:38 01925_jit_aggregation_function_count_long: [ OK ] 0.37 sec. 2026-10-30 10:00:38 02661_read_from_archive_tar: [ OK ] 11.80 sec. 2026-10-30 10:00:38 00623_in_partition_key: [ OK ] 0.52 sec. 2026-10-30 10:00:38 01471_top_k_range_check: [ OK ] 0.32 sec. 2026-10-30 10:00:38 00437_nulls_first_last: [ OK ] 0.42 sec. 2026-10-30 10:00:39 01300_svg: [ OK ] 0.52 sec. 2026-10-30 10:00:39 03211_nested_json_merges: [ SKIPPED ] 0.00 sec. 2026-10-30 10:00:39 Reason: not running for current build 2026-10-30 10:00:39 01455_nullable_type_with_if_agg_combinator: [ OK ] 0.42 sec. 2026-10-30 10:00:39 03203_fill_missed_subcolumns: [ OK ] 0.47 sec. 2026-10-30 10:00:39 01001_enums_in_in_section: [ OK ] 0.32 sec. 2026-10-30 10:00:39 01732_union_and_union_all: [ OK ] 0.27 sec. 2026-10-30 10:00:39 01646_fix_window_funnel_inconistency: [ OK ] 0.32 sec. 2026-10-30 10:00:39 03173_check_cyclic_dependencies_on_create_and_rename: [ OK ] 0.47 sec. 2026-10-30 10:00:39 01333_select_abc_asterisk: [ OK ] 0.32 sec. 2026-10-30 10:00:39 03167_parametrized_view_with_cte: [ OK ] 0.32 sec. 2026-10-30 10:00:40 01460_mark_inclusion_search_crash: [ OK ] 0.32 sec. 2026-10-30 10:00:40 01432_parse_date_time_best_effort_timestamp: [ OK ] 0.27 sec. 2026-10-30 10:00:41 00652_mutations_alter_update: [ OK ] 12.20 sec. 2026-10-30 10:00:42 02907_backup_restore_flatten_nested: [ OK ] 4.33 sec. 2026-10-30 10:00:43 02588_avro_date32_and_decimals: [ OK ] 3.23 sec. 2026-10-30 10:00:43 01889_clickhouse_client_config_format: [ OK ] 4.63 sec. 2026-10-30 10:00:43 02458_insert_select_progress_tcp: [ OK ] 4.43 sec. 2026-10-30 10:00:43 02429_low_cardinality_trash: [ OK ] 1.87 sec. 2026-10-30 10:00:43 01747_alter_partition_key_enum_zookeeper_long: [ OK ] 0.52 sec. 2026-10-30 10:00:44 01389_filter_by_virtual_columns: [ OK ] 0.32 sec. 2026-10-30 10:00:44 01354_order_by_tuple_collate_const: [ OK ] 0.27 sec. 2026-10-30 10:00:44 03215_parquet_index: [ OK ] 0.37 sec. 2026-10-30 10:00:44 00725_join_on_bug_4: [ OK ] 0.32 sec. 2026-10-30 10:00:45 02873_s3_presigned_url_and_url_with_special_characters: [ OK ] 8.59 sec. 2026-10-30 10:00:46 02908_Npy_files_caching: [ OK ] 3.68 sec. 2026-10-30 10:00:46 03012_parser_backtracking: [ OK ] 3.33 sec. 2026-10-30 10:00:47 02352_interactive_queries_from_file: [ OK ] 2.23 sec. 2026-10-30 10:00:47 02734_sparse_columns_short_circuit: [ OK ] 0.32 sec. 2026-10-30 10:00:47 00712_prewhere_with_alias_bug: [ OK ] 0.32 sec. 2026-10-30 10:00:47 01528_clickhouse_local_prepare_parts: [ OK ] 4.53 sec. 2026-10-30 10:00:47 02813_array_agg: [ OK ] 0.32 sec. 2026-10-30 10:00:47 02177_merge_optimize_aggregation_in_order: [ OK ] 0.32 sec. 2026-10-30 10:00:48 02112_skip_index_set_and_or: [ OK ] 0.27 sec. 2026-10-30 10:00:48 00926_zookeeper_adaptive_index_granularity_replicated_merge_tree_long: [ OK ] 8.55 sec. 2026-10-30 10:00:48 00488_column_name_primary: [ OK ] 0.32 sec. 2026-10-30 10:00:48 02751_query_log_test_partitions: [ OK ] 0.67 sec. 2026-10-30 10:00:48 00160_merge_and_index_in_in: [ OK ] 1.47 sec. 2026-10-30 10:00:49 01621_bar_nan_arguments: [ OK ] 0.37 sec. 2026-10-30 10:00:49 00803_odbc_driver_2_format: [ OK ] 0.32 sec. 2026-10-30 10:00:49 01409_topK_merge: [ OK ] 0.37 sec. 2026-10-30 10:00:49 00752_low_cardinality_array_result: [ OK ] 0.32 sec. 2026-10-30 10:00:49 03778_mutation_bad_sparse_cration_with_altered_ration: [ OK ] 0.32 sec. 2026-10-30 10:00:50 00825_protobuf_format_squares: [ OK ] 3.18 sec. 2026-10-30 10:00:50 00251_has_types: [ OK ] 0.37 sec. 2026-10-30 10:00:50 01045_array_zip: [ OK ] 0.37 sec. 2026-10-30 10:00:50 02122_parallel_formatting_PrettyNoEscapes: [ OK ] 5.08 sec. 2026-10-30 10:00:51 00963_startsWith_force_primary_key: [ OK ] 0.32 sec. 2026-10-30 10:00:51 01825_type_json_mutations: [ OK ] 0.32 sec. 2026-10-30 10:00:52 02960_alter_table_part_query_parameter: [ OK ] 0.77 sec. 2026-10-30 10:00:52 01798_uniq_theta_sketch: [ OK ] 1.27 sec. 2026-10-30 10:00:52 02010_lc_native: [ OK ] 3.18 sec. 2026-10-30 10:00:52 01552_dict_fixedstring: [ OK ] 0.32 sec. 2026-10-30 10:00:53 01307_orc_output_format: [ OK ] 4.03 sec. 2026-10-30 10:00:53 03209_parameterized_view_with_non_literal_params: [ OK ] 0.57 sec. 2026-10-30 10:00:53 02737_sql_auto_is_null: [ OK ] 0.32 sec. 2026-10-30 10:00:54 02675_grant_query_formatting: [ OK ] 2.13 sec. 2026-10-30 10:00:54 02992_analyzer_group_by_const: [ OK ] 0.57 sec. 2026-10-30 10:00:54 02142_http_with_query_parameters: [ OK ] 1.92 sec. 2026-10-30 10:00:54 02737_arrayJaccardIndex: [ OK ] 0.52 sec. 2026-10-30 10:00:54 01762_deltasumtimestamp: [ OK ] 0.32 sec. 2026-10-30 10:00:55 02534_join_prewhere_bug: [ OK ] 0.37 sec. 2026-10-30 10:00:55 01082_bit_test_out_of_bound: [ OK ] 0.47 sec. 2026-10-30 10:00:55 02733_sparse_columns_reload: [ OK ] 0.32 sec. 2026-10-30 10:00:55 01312_case_insensitive_regexp: [ OK ] 0.32 sec. 2026-10-30 10:00:55 02896_cyclic_aliases_crash: [ OK ] 0.42 sec. 2026-10-30 10:00:55 01915_json_extract_raw_string: [ OK ] 0.32 sec. 2026-10-30 10:00:55 02294_floating_point_second_in_settings: [ OK ] 6.09 sec. 2026-10-30 10:00:55 00188_constants_as_arguments_of_aggregate_functions: [ OK ] 0.32 sec. 2026-10-30 10:00:55 01602_modified_julian_day_msan: [ OK ] 0.37 sec. 2026-10-30 10:00:56 01655_test_isnull_mysql_dialect: [ OK ] 0.32 sec. 2026-10-30 10:00:56 00277_array_filter: [ OK ] 0.32 sec. 2026-10-30 10:00:56 01508_race_condition_rename_clear_zookeeper_long: [ OK ] 15.86 sec. 2026-10-30 10:00:56 00098_k_union_all: [ OK ] 0.32 sec. 2026-10-30 10:00:56 01702_system_numbers_scientific_notation: [ OK ] 0.32 sec. 2026-10-30 10:00:57 00458_merge_type_cast: [ OK ] 0.67 sec. 2026-10-30 10:00:57 02994_inconsistent_formatting: [ OK ] 0.32 sec. 2026-10-30 10:00:57 01001_rename_merge_race_condition: [ OK ] 13.05 sec. 2026-10-30 10:00:57 02949_ttl_group_by_bug: [ OK ] 0.37 sec. 2026-10-30 10:00:57 02783_parsedatetimebesteffort_syslog: [ OK ] 0.32 sec. 2026-10-30 10:00:57 01453_normalize_query_alias_uuid: [ OK ] 0.32 sec. 2026-10-30 10:00:57 01938_joins_identifiers: [ OK ] 0.32 sec. 2026-10-30 10:00:58 02112_delayed_clickhouse_client_with_queries_file: [ OK ] 2.12 sec. 2026-10-30 10:00:58 01017_uniqCombined_memory_usage: [ OK ] 0.92 sec. 2026-10-30 10:00:58 02416_keeper_map: [ OK ] 0.92 sec. 2026-10-30 10:00:59 01889_check_row_policy_defined_using_user_function: [ OK ] 6.14 sec. 2026-10-30 10:00:59 02876_json_incomplete_types_as_strings_inference: [ OK ] 0.27 sec. 2026-10-30 10:00:59 01771_datetime64_no_time_part: [ OK ] 0.32 sec. 2026-10-30 10:00:59 02439_merge_selecting_partitions: [ OK ] 3.88 sec. 2026-10-30 10:00:59 02661_quantile_approx: [ OK ] 0.67 sec. 2026-10-30 10:00:59 02504_parse_datetime_best_effort_calebeaires: [ OK ] 0.27 sec. 2026-10-30 10:00:59 01845_add_testcase_for_arrayElement: [ OK ] 0.32 sec. 2026-10-30 10:00:59 00834_limit_with_constant_expressions: [ OK ] 0.42 sec. 2026-10-30 10:00:59 00758_array_reverse: [ OK ] 0.42 sec. 2026-10-30 10:01:00 02427_mutate_and_zero_copy_replication_zookeeper: [ OK ] 0.47 sec. 2026-10-30 10:01:00 01268_procfs_metrics: [ OK ] 2.43 sec. 2026-10-30 10:01:00 02950_reading_array_tuple_subcolumns: [ OK ] 0.67 sec. 2026-10-30 10:01:00 00763_create_query_as_table_engine_bug: [ OK ] 0.32 sec. 2026-10-30 10:01:00 00737_decimal_group_by: [ OK ] 0.32 sec. 2026-10-30 10:01:00 02131_materialize_column_cast: [ OK ] 0.42 sec. 2026-10-30 10:01:01 01670_log_comment: [ OK ] 0.47 sec. 2026-10-30 10:01:01 03111_inner_join_group_by: [ OK ] 0.27 sec. 2026-10-30 10:01:01 02096_bad_options_in_client_and_local: [ OK ] 3.88 sec. 2026-10-30 10:01:01 00149_function_url_hash: [ OK ] 0.37 sec. 2026-10-30 10:01:01 01710_projection_group_by_order_by: [ OK ] 0.27 sec. 2026-10-30 10:01:01 02713_array_low_cardinality_string: [ OK ] 0.32 sec. 2026-10-30 10:01:01 00497_whitespaces_in_insert: [ OK ] 5.43 sec. 2026-10-30 10:01:01 01456_low_cardinality_sorting_bugfix: [ OK ] 0.37 sec. 2026-10-30 10:01:01 00956_join_use_nulls_with_array_column: [ OK ] 0.32 sec. 2026-10-30 10:01:01 02008_test_union_distinct_in_subquery: [ OK ] 0.37 sec. 2026-10-30 10:01:01 00506_shard_global_in_union: [ OK ] 0.42 sec. 2026-10-30 10:01:02 03226_alter_update_dynamic_json_not_supported: [ OK ] 0.32 sec. 2026-10-30 10:01:02 00098_a_union_all: [ OK ] 0.33 sec. 2026-10-30 10:01:02 02596_build_set_and_remote: [ OK ] 0.52 sec. 2026-10-30 10:01:02 02803_backup_tmp_files: [ OK ] 2.88 sec. 2026-10-30 10:01:03 01355_CSV_input_format_allow_errors: [ OK ] 3.73 sec. 2026-10-30 10:01:03 02539_vertical_merge_compact_parts: [ OK ] 0.77 sec. 2026-10-30 10:01:03 02294_optimize_aggregation_in_order_prefix_Array_functions: [ OK ] 0.32 sec. 2026-10-30 10:01:03 02242_case_insensitive_column_matching: [ SKIPPED ] 0.00 sec. 2026-10-30 10:01:03 Reason: not running for current build 2026-10-30 10:01:04 02122_parallel_formatting_JSONCompactEachRow: [ OK ] 3.38 sec. 2026-10-30 10:01:05 01825_type_json_16: [ OK ] 3.63 sec. 2026-10-30 10:01:05 01050_engine_join_view_crash: [ OK ] 0.37 sec. 2026-10-30 10:01:05 00460_vertical_and_totals_extremes: [ OK ] 0.32 sec. 2026-10-30 10:01:06 03152_join_filter_push_down_equivalent_columns: [ OK ] 0.32 sec. 2026-10-30 10:01:06 02380_insert_mv_race: [ OK ] 3.13 sec. 2026-10-30 10:01:06 02534_parquet_fixed_binary_array: [ OK ] 4.83 sec. 2026-10-30 10:01:06 02122_parallel_formatting_PrettyCompactNoEscapes: [ OK ] 4.33 sec. 2026-10-30 10:01:06 02311_normalize_utf8_constant: [ OK ] 0.27 sec. 2026-10-30 10:01:07 01096_block_serialized_state: [ OK ] 0.32 sec. 2026-10-30 10:01:07 02831_trash: [ OK ] 0.27 sec. 2026-10-30 10:01:07 01051_new_any_join_engine: [ OK ] 0.47 sec. 2026-10-30 10:01:07 03210_nested_short_circuit_functions_bug: [ OK ] 0.32 sec. 2026-10-30 10:01:07 03201_avro_negative_block_size_arrays: [ OK ] 2.37 sec. 2026-10-30 10:01:07 03213_rand_dos: [ OK ] 0.42 sec. 2026-10-30 10:01:08 01942_dateTimeToSnowflakeID: [ OK ] 0.53 sec. 2026-10-30 10:01:08 02575_map_hashing_msan: [ OK ] 0.32 sec. 2026-10-30 10:01:08 01761_cast_to_enum_nullable: [ OK ] 0.27 sec. 2026-10-30 10:01:08 02192_comment_error: [ OK ] 2.88 sec. 2026-10-30 10:01:09 03145_asof_join_ddb_inequalities: [ OK ] 0.42 sec. 2026-10-30 10:01:09 01935_parametrized_query_parametric_aggregate_function: [ OK ] 1.87 sec. 2026-10-30 10:01:09 01259_datetime64_ubsan: [ OK ] 0.37 sec. 2026-10-30 10:01:10 02011_normalize_utf8: [ OK ] 0.52 sec. 2026-10-30 10:01:10 02112_delayed_clickhouse_local: [ OK ] 2.12 sec. 2026-10-30 10:01:10 01825_type_json_3: [ OK ] 0.52 sec. 2026-10-30 10:01:10 01549_low_cardinality_materialized_view: [ OK ] 0.37 sec. 2026-10-30 10:01:10 02125_dict_get_type_nullable_fix: [ OK ] 0.37 sec. 2026-10-30 10:01:10 02861_interpolate_alias_precedence: [ OK ] 0.32 sec. 2026-10-30 10:01:10 02813_seriesOutliersDetectTukey: [ OK ] 0.52 sec. 2026-10-30 10:01:11 01660_second_extremes_bug: [ OK ] 0.32 sec. 2026-10-30 10:01:11 00910_buffer_prewhere: [ OK ] 0.32 sec. 2026-10-30 10:01:11 00515_enhanced_time_zones: [ OK ] 0.77 sec. 2026-10-30 10:01:11 02004_max_hyperscan_regex_length: [ OK ] 1.07 sec. 2026-10-30 10:01:12 00701_join_default_strictness: [ OK ] 0.32 sec. 2026-10-30 10:01:12 01049_zookeeper_synchronous_mutations_long: [ OK ] 0.68 sec. 2026-10-30 10:01:12 01064_pm_all_join_const_and_nullable: [ OK ] 0.97 sec. 2026-10-30 10:01:12 01556_explain_select_with_union_query: [ OK ] 0.37 sec. 2026-10-30 10:01:12 01682_gather_utils_ubsan: [ OK ] 0.32 sec. 2026-10-30 10:01:12 03456_match_index_prefix_extraction: [ OK ] 0.57 sec. 2026-10-30 10:01:13 02870_per_column_settings: [ OK ] 0.52 sec. 2026-10-30 10:01:13 01576_alter_low_cardinality_and_select: [ OK ] 4.83 sec. 2026-10-30 10:01:13 00719_parallel_ddl_db: [ OK ] 25.99 sec. 2026-10-30 10:01:13 00612_count: [ OK ] 0.47 sec. 2026-10-30 10:01:13 02481_low_cardinality_with_short_circuit_functins: [ OK ] 0.37 sec. 2026-10-30 10:01:13 02504_disallow_arrayjoin_in_mutations: [ OK ] 0.32 sec. 2026-10-30 10:01:14 01276_random_string: [ OK ] 1.48 sec. 2026-10-30 10:01:14 01259_combinator_distinct: [ OK ] 0.42 sec. 2026-10-30 10:01:14 02950_part_log_bytes_uncompressed: [ OK ] 0.62 sec. 2026-10-30 10:01:14 00849_multiple_comma_join_2: [ OK ] 0.72 sec. 2026-10-30 10:01:14 00559_filter_array_generic: [ OK ] 0.27 sec. 2026-10-30 10:01:14 00978_sum_map_bugfix: [ OK ] 0.32 sec. 2026-10-30 10:01:14 02538_analyzer_create_table_as_select: [ OK ] 0.32 sec. 2026-10-30 10:01:14 02461_alter_update_respect_part_column_type_bug: [ OK ] 1.97 sec. 2026-10-30 10:01:15 03014_msan_parse_date_time: [ OK ] 0.32 sec. 2026-10-30 10:01:15 02470_suspicious_low_cardinality_msan: [ OK ] 0.37 sec. 2026-10-30 10:01:15 01211_optimize_skip_unused_shards_type_mismatch: [ OK ] 0.32 sec. 2026-10-30 10:01:15 02024_join_on_or_long: [ OK ] 1.12 sec. 2026-10-30 10:01:15 02891_functions_over_sparse_columns: [ OK ] 0.32 sec. 2026-10-30 10:01:15 01825_new_type_json_nbagames: [ OK ] 9.70 sec. 2026-10-30 10:01:16 03033_create_as_copies_comment: [ OK ] 0.27 sec. 2026-10-30 10:01:16 02346_position_countsubstrings_zero_byte: [ OK ] 0.37 sec. 2026-10-30 10:01:16 02572_query_views_log_background_thread: [ OK ] 13.61 sec. 2026-10-30 10:01:16 00823_sequence_match_dfa: [ OK ] 0.92 sec. 2026-10-30 10:01:16 01019_array_fill: [ OK ] 0.32 sec. 2026-10-30 10:01:16 01958_partial_hour_timezone: [ OK ] 0.32 sec. 2026-10-30 10:01:16 03325_distributed_join_json_array_subcolumns: [ OK ] 0.37 sec. 2026-10-30 10:01:16 02366_explain_query_tree: [ OK ] 0.32 sec. 2026-10-30 10:01:16 02155_nested_lc_defalut_bug: [ OK ] 0.32 sec. 2026-10-30 10:01:16 02503_join_switch_alias_fuzz: [ OK ] 0.27 sec. 2026-10-30 10:01:16 00217_shard_global_subquery_columns_with_same_name: [ OK ] 0.32 sec. 2026-10-30 10:01:17 00444_join_use_nulls: [ OK ] 0.37 sec. 2026-10-30 10:01:17 01448_json_compact_strings_each_row: [ OK ] 0.57 sec. 2026-10-30 10:01:17 02901_remove_nullable_crash_analyzer: [ OK ] 0.42 sec. 2026-10-30 10:01:17 01398_in_tuple_func: [ OK ] 0.32 sec. 2026-10-30 10:01:17 03093_special_column_errors: [ OK ] 0.52 sec. 2026-10-30 10:01:17 02835_fuzz_remove_redundant_sorting: [ OK ] 0.37 sec. 2026-10-30 10:01:17 02871_multiple_joins_rewriter_v2_handle_last_table_columns: [ OK ] 0.32 sec. 2026-10-30 10:01:18 02966_nested_offsets_subcolumn: [ OK ] 0.62 sec. 2026-10-30 10:01:19 02518_parquet_arrow_orc_boolean_value: [ OK ] 2.73 sec. 2026-10-30 10:01:19 02516_projections_with_rollup: [ OK ] 1.92 sec. 2026-10-30 10:01:19 01600_quota_by_forwarded_ip: [ OK ] 2.48 sec. 2026-10-30 10:01:19 03168_fuzz_multiIf_short_circuit: [ OK ] 0.27 sec. 2026-10-30 10:01:19 00308_write_buffer_valid_utf8: [ OK ] 0.27 sec. 2026-10-30 10:01:19 02841_tuple_modulo: [ OK ] 0.27 sec. 2026-10-30 10:01:20 01657_test_toHour_mysql_compatibility: [ OK ] 0.27 sec. 2026-10-30 10:01:20 02834_timestamp_function: [ OK ] 0.42 sec. 2026-10-30 10:01:20 02497_if_transform_strings_to_enum: [ OK ] 0.47 sec. 2026-10-30 10:01:20 02420_stracktrace_debug_symbols: [ OK ] 2.23 sec. 2026-10-30 10:01:20 01600_min_max_compress_block_size: [ OK ] 0.32 sec. 2026-10-30 10:01:20 01825_type_json_nbagames: [ OK ] 6.59 sec. 2026-10-30 10:01:21 00730_unicode_terminal_format: [ OK ] 0.37 sec. 2026-10-30 10:01:21 01096_zeros: [ OK ] 0.37 sec. 2026-10-30 10:01:21 01825_type_json_13: [ OK ] 3.53 sec. 2026-10-30 10:01:21 01274_alter_rename_column_distributed: [ OK ] 0.37 sec. 2026-10-30 10:01:21 00950_bad_alloc_when_truncate_join_storage: [ OK ] 0.27 sec. 2026-10-30 10:01:21 03299_deep_nested_map_creation: [ OK ] 0.27 sec. 2026-10-30 10:01:21 03032_rmt_create_columns_from_replica: [ OK ] 0.37 sec. 2026-10-30 10:01:22 00934_is_valid_utf8: [ OK ] 0.67 sec. 2026-10-30 10:01:22 01013_hex_float: [ OK ] 0.32 sec. 2026-10-30 10:01:22 01560_optimize_on_insert_zookeeper: [ OK ] 0.52 sec. 2026-10-30 10:01:22 02457_parse_date_time_best_effort: [ OK ] 0.47 sec. 2026-10-30 10:01:23 02407_array_element_from_map_wrong_type: [ OK ] 0.32 sec. 2026-10-30 10:01:23 02246_clickhouse_local_drop_database: [ OK ] 2.43 sec. 2026-10-30 10:01:23 01548_uncomparable_columns_in_keys: [ OK ] 0.32 sec. 2026-10-30 10:01:24 00909_kill_not_initialized_query: [ OK ] 9.19 sec. 2026-10-30 10:01:24 03158_dynamic_type_from_variant: [ OK ] 0.32 sec. 2026-10-30 10:01:24 02267_file_globs_schema_inference: [ OK ] 3.68 sec. 2026-10-30 10:01:24 01231_operator_null_in: [ OK ] 1.73 sec. 2026-10-30 10:01:24 03164_early_constant_folding_analyzer: [ OK ] 0.32 sec. 2026-10-30 10:01:24 01044_h3_edge_angle: [ OK ] 0.32 sec. 2026-10-30 10:01:24 01799_long_uniq_theta_sketch: [ OK ] 3.63 sec. 2026-10-30 10:01:24 01458_named_tuple_millin: [ OK ] 0.32 sec. 2026-10-30 10:01:25 01042_check_query_and_last_granule_size: [ OK ] 0.47 sec. 2026-10-30 10:01:25 02503_in_lc_const_args_bug: [ OK ] 0.27 sec. 2026-10-30 10:01:25 02577_keepermap_delete_update: [ OK ] 0.52 sec. 2026-10-30 10:01:25 02461_welch_t_test_fuzz: [ OK ] 0.32 sec. 2026-10-30 10:01:25 00199_ternary_operator_type_check: [ OK ] 0.47 sec. 2026-10-30 10:01:25 03262_column_sizes_with_dynamic_structure: [ OK ] 1.72 sec. 2026-10-30 10:01:25 02151_lc_prefetch: [ SKIPPED ] 0.00 sec. 2026-10-30 10:01:25 Reason: not running for current build 2026-10-30 10:01:26 00506_union_distributed: [ OK ] 0.42 sec. 2026-10-30 10:01:26 00720_with_cube: [ OK ] 0.37 sec. 2026-10-30 10:01:26 01324_settings_documentation: [ OK ] 0.27 sec. 2026-10-30 10:01:26 01497_extract_all_groups_empty_match: [ OK ] 0.27 sec. 2026-10-30 10:01:26 02016_agg_empty_result_bug_28880: [ OK ] 0.32 sec. 2026-10-30 10:01:26 02015_async_inserts_1: [ OK ] 7.74 sec. 2026-10-30 10:01:27 01781_merge_tree_deduplication: [ OK ] 0.73 sec. 2026-10-30 10:01:27 01932_global_in_function: [ OK ] 0.27 sec. 2026-10-30 10:01:27 00839_bitmask_negative: [ OK ] 0.37 sec. 2026-10-30 10:01:27 03140_client_subsequent_external_tables: [ OK ] 2.13 sec. 2026-10-30 10:01:27 00459_group_array_insert_at: [ OK ] 0.32 sec. 2026-10-30 10:01:28 01056_predicate_optimizer_bugs: [ OK ] 0.57 sec. 2026-10-30 10:01:28 02237_lzma_bug: [ OK ] 4.18 sec. 2026-10-30 10:01:28 03243_create_or_replace_view_dependency_check: [ OK ] 0.37 sec. 2026-10-30 10:01:28 00834_not_between: [ OK ] 0.32 sec. 2026-10-30 10:01:29 01071_in_array: [ OK ] 0.27 sec. 2026-10-30 10:01:29 02833_local_with_dialect: [ OK ] 2.17 sec. 2026-10-30 10:01:29 02510_group_by_prewhere_null: [ OK ] 0.37 sec. 2026-10-30 10:01:29 01523_client_local_queries_file_parameter: [ OK ] 3.43 sec. 2026-10-30 10:01:29 01214_test_storage_merge_aliases_with_where: [ OK ] 0.47 sec. 2026-10-30 10:01:29 02009_array_join_partition: [ OK ] 0.32 sec. 2026-10-30 10:01:30 02789_jit_cannot_convert_column: [ OK ] 0.27 sec. 2026-10-30 10:01:30 00752_low_cardinality_left_array_join: [ OK ] 0.32 sec. 2026-10-30 10:01:31 00240_replace_substring_loop: [ OK ] 0.82 sec. 2026-10-30 10:01:31 00909_ngram_distance: [ OK ] 1.12 sec. 2026-10-30 10:01:31 01825_type_json_ghdata_insert_select: [ OK ] 8.49 sec. 2026-10-30 10:01:31 00712_prewhere_with_final: [ OK ] 0.66 sec. 2026-10-30 10:01:31 02771_skip_empty_files: [ OK ] 5.28 sec. 2026-10-30 10:01:31 00674_has_array_enum: [ OK ] 0.58 sec. 2026-10-30 10:01:32 00619_extract: [ OK ] 0.48 sec. 2026-10-30 10:01:32 00875_join_right_nulls_ors: [ OK ] 0.66 sec. 2026-10-30 10:01:32 02473_extract_low_cardinality_from_json: [ OK ] 0.38 sec. 2026-10-30 10:01:32 02231_hierarchical_dictionaries_constant: [ OK ] 0.69 sec. 2026-10-30 10:01:32 03015_aggregator_empty_data_multiple_blocks: [ OK ] 0.39 sec. 2026-10-30 10:01:32 02133_distributed_queries_formatting: [ OK ] 0.59 sec. 2026-10-30 10:01:32 03215_validate_type_in_alter_add_modify_column: [ OK ] 0.54 sec. 2026-10-30 10:01:33 01199_url_functions_path_without_schema_yiurule: [ OK ] 0.34 sec. 2026-10-30 10:01:33 02177_sum_if_not_found: [ OK ] 0.63 sec. 2026-10-30 10:01:33 02789_functions_after_sorting_and_columns_with_same_names_bug_2: [ OK ] 0.63 sec. 2026-10-30 10:01:33 03169_modify_column_data_loss: [ OK ] 0.58 sec. 2026-10-30 10:01:34 01119_session_log: [ OK ] 30.72 sec. 2026-10-30 10:01:35 02875_json_array_as_string: [ OK ] 0.53 sec. 2026-10-30 10:01:35 02130_parse_quoted_null: [ OK ] 8.05 sec. 2026-10-30 10:01:35 02354_numeric_literals_with_underscores: [ OK ] 0.59 sec. 2026-10-30 10:01:36 02351_Map_combinator_dist: [ OK ] 0.64 sec. 2026-10-30 10:01:36 00947_ml_test: [ OK ] 0.68 sec. 2026-10-30 10:01:37 02911_cte_invalid_query_analysis: [ OK ] 0.44 sec. 2026-10-30 10:01:37 01825_new_type_json_11: [ OK ] 7.75 sec. 2026-10-30 10:01:37 00431_if_nulls: [ OK ] 0.88 sec. 2026-10-30 10:01:38 02582_async_reading_with_small_limit: [ OK ] 0.45 sec. 2026-10-30 10:01:38 03172_http_content_encoding: [ OK ] 4.74 sec. 2026-10-30 10:01:38 01244_optimize_distributed_group_by_sharding_key: [ OK ] 1.15 sec. 2026-10-30 10:01:38 00354_host_command_line_option: [ OK ] 4.85 sec. 2026-10-30 10:01:39 00623_truncate_table: [ OK ] 0.69 sec. 2026-10-30 10:01:39 02472_segfault_expression_parser: [ OK ] 0.53 sec. 2026-10-30 10:01:39 00647_histogram: [ OK ] 0.59 sec. 2026-10-30 10:01:39 01071_window_view_event_tumble_asc_join: [ OK ] 6.91 sec. 2026-10-30 10:01:39 03305_compressed_memory_eng_crash_reading_subcolumn: [ OK ] 0.48 sec. 2026-10-30 10:01:39 00071_insert_fewer_columns: [ OK ] 0.37 sec. 2026-10-30 10:01:39 01071_prohibition_secondary_index_with_old_format_merge_tree: [ OK ] 0.42 sec. 2026-10-30 10:01:40 03200_subcolumns_join_use_nulls: [ OK ] 0.44 sec. 2026-10-30 10:01:40 01475_read_subcolumns_3: [ OK ] 0.69 sec. 2026-10-30 10:01:40 01667_aes_args_check: [ OK ] 0.34 sec. 2026-10-30 10:01:40 02476_fuse_sum_count: [ OK ] 0.65 sec. 2026-10-30 10:01:41 01796_Log_rwlock_ub: [ OK ] 0.59 sec. 2026-10-30 10:01:41 02523_range_const_start: [ OK ] 0.59 sec. 2026-10-30 10:01:42 02918_parallel_replicas_custom_key_unavailable_replica: [ OK ] 0.63 sec. 2026-10-30 10:01:42 02358_file_default_value: [ OK ] 4.71 sec. 2026-10-30 10:01:42 02911_arrow_large_list: [ OK ] 3.45 sec. 2026-10-30 10:01:42 03263_analyzer_materialized_view_cte_nested: [ OK ] 0.69 sec. 2026-10-30 10:01:42 00554_nested_and_table_engines: [ OK ] 0.68 sec. 2026-10-30 10:01:43 02910_replicated_merge_parameters_must_consistent: [ OK ] 0.88 sec. 2026-10-30 10:01:43 02705_grouping_keys_equal_keys: [ OK ] 0.53 sec. 2026-10-30 10:01:43 00603_system_parts_nonexistent_database: [ OK ] 0.39 sec. 2026-10-30 10:01:44 01813_quantileBfloat16_nans: [ OK ] 0.59 sec. 2026-10-30 10:01:44 01581_deduplicate_by_columns_local: [ OK ] 0.77 sec. 2026-10-30 10:01:44 02561_temporary_table_grants: [ OK ] 10.49 sec. 2026-10-30 10:01:44 03006_buffer_overflow_join: [ OK ] 0.40 sec. 2026-10-30 10:01:44 01418_index_analysis_bug: [ OK ] 0.44 sec. 2026-10-30 10:01:45 02560_quantile_min_max: [ OK ] 0.54 sec. 2026-10-30 10:01:45 00968_roundAge: [ OK ] 0.49 sec. 2026-10-30 10:01:45 01652_ttl_old_syntax: [ OK ] 0.53 sec. 2026-10-30 10:01:45 01685_ssd_cache_dictionary_complex_key: [ OK ] 3.35 sec. 2026-10-30 10:01:45 02163_operators: [ OK ] 0.53 sec. 2026-10-30 10:01:45 02676_kafka_murmur_hash: [ OK ] 0.39 sec. 2026-10-30 10:01:45 00495_reading_const_zero_column: [ OK ] 0.49 sec. 2026-10-30 10:01:46 01664_array_slice_ubsan: [ OK ] 0.37 sec. 2026-10-30 10:01:46 02730_with_fill_by_sorting_prefix: [ OK ] 0.58 sec. 2026-10-30 10:01:46 01812_has_generic: [ OK ] 0.49 sec. 2026-10-30 10:01:46 02541_empty_function_support_ip: [ OK ] 0.64 sec. 2026-10-30 10:01:47 02988_join_using_prewhere_pushdown: [ OK ] 0.58 sec. 2026-10-30 10:01:47 02933_replicated_database_forbid_create_as_select: [ OK ] 7.91 sec. 2026-10-30 10:01:48 01053_drop_database_mat_view: [ OK ] 0.63 sec. 2026-10-30 10:01:48 01116_asof_join_dolbyzerr: [ OK ] 0.58 sec. 2026-10-30 10:01:48 01308_row_policy_and_trivial_count_query: [ OK ] 0.59 sec. 2026-10-30 10:01:49 00937_format_schema_rows_template: [ OK ] 7.02 sec. 2026-10-30 10:01:49 03207_json_read_subcolumns_2_memory: [ SKIPPED ] 0.00 sec. 2026-10-30 10:01:49 Reason: not running for current build 2026-10-30 10:01:49 01559_misplaced_codec_diagnostics: [ OK ] 0.53 sec. 2026-10-30 10:01:50 00065_shard_float_literals_formatting: [ OK ] 0.60 sec. 2026-10-30 10:01:50 01451_wrong_error_long_query: [ OK ] 3.45 sec. 2026-10-30 10:01:50 02954_analyzer_fuzz_i57086: [ OK ] 0.49 sec. 2026-10-30 10:01:50 01375_null_issue_3767: [ OK ] 0.38 sec. 2026-10-30 10:01:50 02579_fill_empty_chunk_analyzer: [ OK ] 0.59 sec. 2026-10-30 10:01:50 00507_array_no_params: [ OK ] 4.34 sec. 2026-10-30 10:01:50 02790_url_multiple_tsv_files: [ OK ] 0.79 sec. 2026-10-30 10:01:51 02493_do_not_assume_that_the_original_query_was_valid_when_transforming_joins: [ OK ] 0.47 sec. 2026-10-30 10:01:51 03005_input_function_in_join: [ OK ] 0.39 sec. 2026-10-30 10:01:51 01633_limit_fuzz: [ OK ] 0.49 sec. 2026-10-30 10:01:51 03166_mv_prewhere_duplicating_name_bug: [ OK ] 0.47 sec. 2026-10-30 10:01:51 00038_totals_limit: [ OK ] 0.59 sec. 2026-10-30 10:01:51 02181_format_describe_query: [ OK ] 3.46 sec. 2026-10-30 10:01:52 02184_ipv6_cast_test: [ OK ] 0.59 sec. 2026-10-30 10:01:52 02451_variadic_null_garbage_data: [ OK ] 0.43 sec. 2026-10-30 10:01:52 03105_table_aliases_in_mv: [ OK ] 0.63 sec. 2026-10-30 10:01:52 02456_async_inserts_logs: [ OK ] 12.78 sec. 2026-10-30 10:01:52 02874_parse_json_as_json_each_row_on_no_metadata: [ OK ] 0.53 sec. 2026-10-30 10:01:52 03003_count_asterisk_filter: [ OK ] 0.58 sec. 2026-10-30 10:01:52 01424_parse_date_time_bad_date: [ OK ] 0.37 sec. 2026-10-30 10:01:52 01472_many_rows_in_totals: [ OK ] 0.39 sec. 2026-10-30 10:01:52 00820_multiple_joins_subquery_requires_alias: [ OK ] 0.69 sec. 2026-10-30 10:01:53 02540_duplicate_primary_key2: [ OK ] 0.38 sec. 2026-10-30 10:01:53 02680_datetime64_monotonic_check: [ OK ] 0.65 sec. 2026-10-30 10:01:53 02012_zookeeper_changed_enum_type: [ OK ] 0.63 sec. 2026-10-30 10:01:53 02186_range_hashed_dictionary_intersecting_intervals: [ OK ] 0.69 sec. 2026-10-30 10:01:53 00981_in_subquery_with_tuple: [ OK ] 8.01 sec. 2026-10-30 10:01:54 03040_recursive_cte_postgres_6: [ OK ] 0.63 sec. 2026-10-30 10:01:54 01851_hedged_connections_external_tables: [ OK ] 0.48 sec. 2026-10-30 10:01:54 01120_join_constants: [ OK ] 0.43 sec. 2026-10-30 10:01:54 00933_alter_ttl: [ OK ] 0.70 sec. 2026-10-30 10:01:54 01662_join_mixed: [ OK ] 0.55 sec. 2026-10-30 10:01:54 02184_range_hashed_dictionary_outside_range_values: [ OK ] 0.57 sec. 2026-10-30 10:01:54 01060_defaults_all_columns: [ OK ] 0.58 sec. 2026-10-30 10:01:54 02100_now64_types_bug: [ OK ] 0.59 sec. 2026-10-30 10:01:55 02713_ip4_uint_compare: [ OK ] 0.58 sec. 2026-10-30 10:01:55 02352_grouby_shadows_arg: [ OK ] 0.60 sec. 2026-10-30 10:01:55 03149_variant_pop_back_typo: [ OK ] 0.39 sec. 2026-10-30 10:01:55 03209_json_type_horizontal_merges: [ SKIPPED ] 0.00 sec. 2026-10-30 10:01:55 Reason: not running for current build 2026-10-30 10:01:55 01716_drop_rename_sign_column: [ OK ] 0.49 sec. 2026-10-30 10:01:55 02381_client_prints_server_side_time: [ SKIPPED ] 0.00 sec. 2026-10-30 10:01:55 Reason: not running for current build 2026-10-30 10:01:55 03262_analyzer_materialized_view_in_with_cte: [ OK ] 0.42 sec. 2026-10-30 10:01:55 01582_distinct_subquery_groupby: [ OK ] 0.70 sec. 2026-10-30 10:01:56 02675_sparse_columns_clear_column: [ OK ] 1.14 sec. 2026-10-30 10:01:56 02981_variant_type_function: [ OK ] 0.53 sec. 2026-10-30 10:01:56 01720_join_implicit_cast: [ OK ] 1.25 sec. 2026-10-30 10:01:57 01483_merge_table_join_and_group_by: [ OK ] 0.69 sec. 2026-10-30 10:01:57 03006_join_on_inequal_expression_2: [ OK ] 1.18 sec. 2026-10-30 10:01:57 01032_cityHash64_for_decimal: [ OK ] 0.38 sec. 2026-10-30 10:01:58 02973_analyzer_join_use_nulls_column_not_found: [ OK ] 0.62 sec. 2026-10-30 10:02:00 02721_parquet_field_not_found: [ OK ] 4.49 sec. 2026-10-30 10:02:00 02029_test_implemented_methods: [ OK ] 3.34 sec. 2026-10-30 10:02:00 02461_cancel_finish_race: [ OK ] 31.90 sec. 2026-10-30 10:02:00 00100_subquery_table_identifier: [ OK ] 5.35 sec. 2026-10-30 10:02:00 00696_system_columns_limit: [ OK ] 0.49 sec. 2026-10-30 10:02:00 02681_undrop_query_uuid: [ OK ] 8.21 sec. 2026-10-30 10:02:00 02723_param_exception_message_context: [ OK ] 3.49 sec. 2026-10-30 10:02:00 02343_group_by_use_nulls: [ OK ] 0.37 sec. 2026-10-30 10:02:00 02696_ignore_inacc_tables_mat_view_atttach: [ OK ] 0.32 sec. 2026-10-30 10:02:01 03165_string_functions_with_token_text_indexes: [ OK ] 0.94 sec. 2026-10-30 10:02:01 01838_system_dictionaries_virtual_key_column: [ OK ] 0.32 sec. 2026-10-30 10:02:01 02572_max_intersections: [ OK ] 0.27 sec. 2026-10-30 10:02:01 02950_parallel_replicas_used_count: [ OK ] 0.87 sec. 2026-10-30 10:02:01 00273_quantiles: [ OK ] 0.42 sec. 2026-10-30 10:02:01 02705_projection_and_ast_optimizations_bug: [ OK ] 0.32 sec. 2026-10-30 10:02:01 02811_invalid_embedded_rocksdb_create: [ OK ] 0.32 sec. 2026-10-30 10:02:01 01416_join_totals_header_bug: [ OK ] 0.37 sec. 2026-10-30 10:02:01 00098_6_union_all: [ OK ] 0.32 sec. 2026-10-30 10:02:01 03007_column_nullable_uninitialzed_value: [ OK ] 0.27 sec. 2026-10-30 10:02:02 01318_encrypt: [ OK ] 0.77 sec. 2026-10-30 10:02:02 02501_analyzer_expired_context_crash_fix: [ OK ] 0.27 sec. 2026-10-30 10:02:02 02366_kql_operator_in_sql: [ OK ] 0.42 sec. 2026-10-30 10:02:03 01648_mutations_and_escaping: [ OK ] 4.35 sec. 2026-10-30 10:02:04 03206_no_exceptions_clickhouse_local: [ FAIL ] 2.12 sec. 2026-10-30 10:02:04 Reason: return code: 134, result: 2026-10-30 10:02:04 2026-10-30 10:02:04 2026-10-30 10:02:04 2026-10-30 10:02:04 stdout: 2026-10-30 10:02:04 2026-10-30 10:02:04 2026-10-30 10:02:04 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 521972 --group_by_two_level_threshold_bytes 50000000 --distributed_aggregation_memory_efficient 1 --fsync_metadata 0 --output_format_parallel_formatting 0 --input_format_parallel_parsing 1 --min_chunk_bytes_for_parallel_parsing 9453381 --max_read_buffer_size 855296 --prefer_localhost_replica 1 --max_block_size 89453 --max_joined_block_size_rows 34311 --max_threads 1 --optimize_append_index 1 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 0 --optimize_or_like_chain 1 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 47 --optimize_aggregation_in_order 1 --aggregation_in_order_max_block_bytes 32905441 --use_uncompressed_cache 0 --min_bytes_to_use_direct_io 1 --min_bytes_to_use_mmap_io 10428965201 --local_filesystem_read_method io_uring --remote_filesystem_read_method read --local_filesystem_read_prefetch 1 --filesystem_cache_segments_batch_size 50 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 0 --throw_on_error_from_cache_on_write_operations 0 --remote_filesystem_read_prefetch 0 --allow_prefetched_read_pool_for_remote_filesystem 1 --filesystem_prefetch_max_memory_usage 32Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 100Mi --compile_aggregate_expressions 0 --compile_sort_description 0 --merge_tree_coarse_index_granularity 6 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 4235748916 --max_bytes_before_remerge_sort 2484403605 --min_compress_block_size 2362675 --max_compress_block_size 1104272 --merge_tree_compact_parts_min_granules_to_multibuffer_read 119 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 5624975 --http_wait_end_of_query False --enable_memory_bound_merging_of_aggregation_results 0 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 3 --min_count_to_compile_sort_description 3 --session_timezone America/Mazatlan --use_page_cache_for_disks_without_file_cache True --page_cache_inject_eviction True --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.58 --prefer_external_sort_block_bytes 1 --cross_join_min_rows_to_compress 1 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 0 --max_parsing_threads 1 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 0 2026-10-30 10:02:04 2026-10-30 10:02:04 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 0 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 16262626 --merge_max_block_size 10146 --index_granularity 57828 --min_bytes_for_wide_part 764876 --marks_compress_block_size 32565 --primary_key_compress_block_size 33955 --replace_long_file_name_to_hash 1 --max_file_name_length 128 --min_bytes_for_full_part_storage 0 --compact_parts_max_bytes_to_buffer 313236701 --compact_parts_max_granules_to_buffer 47 --compact_parts_merge_max_bytes_to_prefetch_part 33127829 --cache_populated_by_fetch 1 --concurrent_part_removal_threshold 100 --old_parts_lifetime 480 2026-10-30 10:02:04 2026-10-30 10:02:04 Database: test_b8rz91wh 2026-10-30 10:02:04 01721_join_implicit_cast_long: [ OK ] 3.53 sec. 2026-10-30 10:02:04 01768_extended_range: [ OK ] 0.32 sec. 2026-10-30 10:02:04 00945_bloom_filter_index: [ OK ] 2.78 sec. 2026-10-30 10:02:04 00819_ast_refactoring_bugs: [ OK ] 0.42 sec. 2026-10-30 10:02:05 01767_timezoneOf: [ OK ] 2.17 sec. 2026-10-30 10:02:05 02526_kv_engine_different_filter_type: [ OK ] 0.42 sec. 2026-10-30 10:02:05 03228_variant_permutation_issue: [ OK ] 0.47 sec. 2026-10-30 10:02:05 01187_set_profile_as_setting: [ OK ] 2.98 sec. 2026-10-30 10:02:05 01822_union_and_constans_error: [ OK ] 0.27 sec. 2026-10-30 10:02:05 00617_array_in: [ OK ] 0.32 sec. 2026-10-30 10:02:05 03033_set_index_in: [ OK ] 0.42 sec. 2026-10-30 10:02:06 00500_point_in_polygon_non_const_poly: [ OK ] 0.72 sec. 2026-10-30 10:02:06 02151_replace_regexp_all_empty_match_alternative: [ OK ] 0.32 sec. 2026-10-30 10:02:06 01781_token_extractor_buffer_overflow: [ OK ] 0.42 sec. 2026-10-30 10:02:06 01039_row_policy_dcl: [ OK ] 2.17 sec. 2026-10-30 10:02:06 02030_function_mapContainsKeyLike: [ OK ] 0.37 sec. 2026-10-30 10:02:06 02285_hex_bin_support_more_types: [ OK ] 0.37 sec. 2026-10-30 10:02:06 01529_bad_memory_tracking: [ OK ] 4.33 sec. 2026-10-30 10:02:06 02998_to_milliseconds: [ OK ] 0.42 sec. 2026-10-30 10:02:06 02943_variant_element: [ OK ] 0.37 sec. 2026-10-30 10:02:06 01719_join_timezone: [ OK ] 0.37 sec. 2026-10-30 10:02:06 01678_great_circle_angle: [ OK ] 0.32 sec. 2026-10-30 10:02:06 02900_window_function_with_sparse_column: [ OK ] 0.37 sec. 2026-10-30 10:02:06 02017_columns_with_dot_2: [ OK ] 0.32 sec. 2026-10-30 10:02:07 02242_optimize_to_subcolumns_no_storage: [ OK ] 0.27 sec. 2026-10-30 10:02:07 02751_multiif_to_if_crash: [ OK ] 0.32 sec. 2026-10-30 10:02:07 00262_alter_alias: [ OK ] 0.37 sec. 2026-10-30 10:02:07 01410_full_join_and_null_predicates: [ OK ] 0.47 sec. 2026-10-30 10:02:07 01748_partition_id_pruning: [ OK ] 0.37 sec. 2026-10-30 10:02:07 00520_tuple_values_interpreter: [ OK ] 0.32 sec. 2026-10-30 10:02:08 03167_empty_tuple_concat: [ OK ] 0.27 sec. 2026-10-30 10:02:08 02356_insert_query_log_metrics: [ OK ] 0.77 sec. 2026-10-30 10:02:08 02969_auto_format_detection: [ OK ] 17.30 sec. 2026-10-30 10:02:08 00467_qualified_names: [ OK ] 0.42 sec. 2026-10-30 10:02:08 01273_arrow_load: [ OK ] 3.08 sec. 2026-10-30 10:02:08 2026-10-30 10:02:08 Having 1 errors! 438 tests passed. 8 tests skipped. 734.38 s elapsed (Process-4). 2026-10-30 10:02:08 01268_mergine_sorted_limit: [ OK ] 0.37 sec. 2026-10-30 10:02:08 2026-10-30 10:02:08 439 tests passed. 8 tests skipped. 734.46 s elapsed (Process-7). 2026-10-30 10:02:08 02294_system_certificates: [ OK ] 0.27 sec. 2026-10-30 10:02:08 2026-10-30 10:02:08 296 tests passed. 4 tests skipped. 734.62 s elapsed (Process-3). 2026-10-30 10:02:09 02874_toDaysSinceYearZero: [ OK ] 0.47 sec. 2026-10-30 10:02:09 2026-10-30 10:02:09 448 tests passed. 6 tests skipped. 734.79 s elapsed (Process-10). 2026-10-30 10:02:09 02344_describe_cache: [ OK ] 2.67 sec. 2026-10-30 10:02:09 2026-10-30 10:02:09 454 tests passed. 7 tests skipped. 735.19 s elapsed (Process-8). 2026-10-30 10:02:09 01544_file_engine_settings: [ OK ] 2.68 sec. 2026-10-30 10:02:09 2026-10-30 10:02:09 420 tests passed. 4 tests skipped. 735.27 s elapsed (Process-5). 2026-10-30 10:02:13 01444_create_table_drop_database_race: [ OK ] 12.05 sec. 2026-10-30 10:02:13 2026-10-30 10:02:13 306 tests passed. 5 tests skipped. 738.76 s elapsed (Process-6). 2026-10-30 10:02:19 03039_dynamic_collapsing_merge_tree: [ OK ] 11.86 sec. 2026-10-30 10:02:19 2026-10-30 10:02:19 Having 1 errors! 412 tests passed. 3 tests skipped. 744.79 s elapsed (Process-9). 2026-10-30 10:02:25 Running 282 stateless tests (MainProcess). 2026-10-30 10:02:31 03231_restore_user_with_existing_role: [ OK ] 5.99 sec. 2026-10-30 10:02:36 03206_replication_lag_metric: [ OK ] 5.44 sec. 2026-10-30 10:02:37 03198_table_function_directory_path: [ OK ] 0.37 sec. 2026-10-30 10:02:37 03198_dynamic_read_subcolumns: [ OK ] 0.52 sec. 2026-10-30 10:02:38 03168_loop_engine_with_parallel_replicas: [ OK ] 0.32 sec. 2026-10-30 10:02:41 03154_lazy_token_iterator: [ OK ] 3.03 sec. 2026-10-30 10:02:58 03151_unload_index_race: [ OK ] 17.82 sec. 2026-10-30 10:03:20 03147_system_columns_access_checks: [ OK ] 20.49 sec. 2026-10-30 10:03:20 03147_parquet_memory_tracking: [ OK ] 0.77 sec. 2026-10-30 10:03:21 03147_table_function_loop: [ OK ] 0.37 sec. 2026-10-30 10:04:10 03008_deduplication_mv_generates_several_blocks_replicated: [ OK ] 49.57 sec. 2026-10-30 10:04:16 03008_s3_plain_rewritable_fault: [ OK ] 5.59 sec. 2026-10-30 10:04:53 03008_deduplication_several_mv_into_one_table_nonreplicated: [ OK ] 36.64 sec. 2026-10-30 10:05:29 03008_deduplication_insert_several_blocks_nonreplicated: [ OK ] 35.93 sec. 2026-10-30 10:06:17 03008_deduplication_insert_several_blocks_replicated: [ OK ] 48.27 sec. 2026-10-30 10:06:20 03002_part_log_rmt_fetch_merge_error: [ OK ] 3.63 sec. 2026-10-30 10:06:28 03002_part_log_rmt_fetch_mutate_error: [ OK ] 7.75 sec. 2026-10-30 10:06:29 02990_rmt_replica_path_uuid: [ OK ] 0.47 sec. 2026-10-30 10:06:31 02980_dist_insert_readonly_replica: [ OK ] 2.68 sec. 2026-10-30 10:06:35 02973_backup_of_in_memory_compressed: [ OK ] 3.48 sec. 2026-10-30 10:07:21 02962_system_sync_replica_lightweight_from_modifier: [ OK ] 45.96 sec. 2026-10-30 10:07:22 02961_drop_tables: [ OK ] 0.52 sec. 2026-10-30 10:07:22 02960_partition_by_udf: [ OK ] 0.37 sec. 2026-10-30 10:07:31 02944_dynamically_change_filesystem_cache_size: [ OK ] 8.70 sec. 2026-10-30 10:07:36 02943_rmt_alter_metadata_merge_checksum_mismatch: [ OK ] 5.09 sec. 2026-10-30 10:07:36 02931_max_num_to_warn: [ OK ] 0.47 sec. 2026-10-30 10:07:40 02916_move_partition_inactive_replica: [ OK ] 3.78 sec. 2026-10-30 10:07:43 02915_move_partition_inactive_replica: [ OK ] 3.03 sec. 2026-10-30 10:07:44 02911_row_policy_on_cluster: [ OK ] 0.67 sec. 2026-10-30 10:07:44 02910_prefetch_unexpceted_exception: [ OK ] 0.37 sec. 2026-10-30 10:07:45 02908_empty_named_collection: [ OK ] 0.32 sec. 2026-10-30 10:07:49 02908_many_requests_to_system_replicas: [ OK ] 4.38 sec. 2026-10-30 10:07:54 02888_replicated_merge_tree_creation: [ OK ] 4.89 sec. 2026-10-30 10:07:55 02887_insert_quorum_wo_keeper_retries: [ OK ] 0.47 sec. 2026-10-30 10:07:55 02884_async_insert_skip_settings: [ OK ] 0.57 sec. 2026-10-30 10:07:59 02884_async_insert_native_protocol_3: [ OK ] 3.58 sec. 2026-10-30 10:07:59 02874_parquet_multiple_batches_array_inconsistent_offsets: [ SKIPPED ] 0.00 sec. 2026-10-30 10:07:59 Reason: not running for current build 2026-10-30 10:08:10 02871_peak_threads_usage: [ OK ] 11.11 sec. 2026-10-30 10:08:10 02867_create_user_ssh: [ OK ] 0.32 sec. 2026-10-30 10:08:11 02863_delayed_source_with_totals_and_extremes: [ OK ] 0.47 sec. 2026-10-30 10:08:13 02845_threads_count_in_distributed_queries: [ OK ] 1.57 sec. 2026-10-30 10:08:15 02843_insertion_table_schema_infer: [ OK ] 2.23 sec. 2026-10-30 10:08:16 02841_parquet_filter_pushdown: [ OK ] 1.62 sec. 2026-10-30 10:08:17 02833_multiprewhere_extra_column: [ OK ] 0.47 sec. 2026-10-30 10:08:23 02808_filesystem_cache_drop_query: [ OK ] 5.89 sec. 2026-10-30 10:08:24 02796_calculate_text_stack_trace: [ OK ] 0.97 sec. 2026-10-30 10:08:30 02789_filesystem_cache_alignment: [ OK ] 5.84 sec. 2026-10-30 10:08:33 02789_table_functions_errors: [ OK ] 2.73 sec. 2026-10-30 10:08:33 02782_uniq_exact_parallel_merging_bug: [ SKIPPED ] 0.00 sec. 2026-10-30 10:08:33 Reason: not running for current build 2026-10-30 10:08:35 02775_show_columns_called_from_mysql: [ OK ] 2.08 sec. 2026-10-30 10:08:35 02762_replicated_database_no_args: [ OK ] 0.32 sec. 2026-10-30 10:08:36 02751_ip_types_aggregate_functions_states: [ OK ] 0.52 sec. 2026-10-30 10:08:39 02736_reading_and_writing_structure_fields: [ OK ] 3.53 sec. 2026-10-30 10:08:41 02735_capnp_case_insensitive_names_matching: [ OK ] 2.23 sec. 2026-10-30 10:08:43 02735_parquet_encoder: [ OK ] 1.93 sec. 2026-10-30 10:08:44 02725_url_support_virtual_column: [ OK ] 0.37 sec. 2026-10-30 10:09:11 02725_start_stop_fetches: [ OK ] 27.20 sec. 2026-10-30 10:09:11 02710_default_replicated_parameters: [ OK ] 0.37 sec. 2026-10-30 10:09:12 02706_show_columns: [ OK ] 0.62 sec. 2026-10-30 10:09:25 02700_s3_part_INT_MAX: [ OK ] 12.61 sec. 2026-10-30 10:09:25 02581_share_big_sets_between_mutation_tasks_long: [ SKIPPED ] 0.00 sec. 2026-10-30 10:09:25 Reason: not running for current build 2026-10-30 10:09:25 02572_system_logs_materialized_views_ignore_errors: [ OK ] 0.62 sec. 2026-10-30 10:09:31 02566_ipv4_ipv6_binary_formats: [ OK ] 6.14 sec. 2026-10-30 10:09:33 02561_temporary_table_sessions: [ OK ] 2.08 sec. 2026-10-30 10:09:36 02541_arrow_duration_type: [ OK ] 2.53 sec. 2026-10-30 10:09:53 02535_max_parallel_replicas_custom_key_mt: [ OK ] 17.28 sec. 2026-10-30 10:10:11 02535_max_parallel_replicas_custom_key_rmt: [ OK ] 17.38 sec. 2026-10-30 10:10:13 02522_avro_complicate_schema: [ OK ] 2.48 sec. 2026-10-30 10:10:45 02515_cleanup_async_insert_block_ids: [ OK ] 32.12 sec. 2026-10-30 10:10:48 02510_orc_map_indexes: [ OK ] 2.22 sec. 2026-10-30 10:10:51 02503_cache_on_write_with_small_segment_size: [ OK ] 3.73 sec. 2026-10-30 10:10:56 02503_insert_storage_snapshot: [ OK ] 4.23 sec. 2026-10-30 10:10:58 02501_deep_recusion_schema_inference: [ OK ] 2.53 sec. 2026-10-30 10:11:10 02497_trace_events_stress_long: [ OK ] 11.80 sec. 2026-10-30 10:11:10 02495_s3_filter_by_file: [ OK ] 0.47 sec. 2026-10-30 10:11:11 02494_query_cache_user_quotas_after_drop: [ OK ] 0.37 sec. 2026-10-30 10:11:12 02494_query_cache_query_log: [ OK ] 0.77 sec. 2026-10-30 10:11:12 02494_query_cache_case_agnostic_matching: [ OK ] 0.52 sec. 2026-10-30 10:11:13 02494_query_cache_compression: [ OK ] 0.32 sec. 2026-10-30 10:11:13 02494_query_cache_totals_extremes: [ OK ] 0.37 sec. 2026-10-30 10:11:13 02494_query_cache_exception_handling: [ OK ] 0.27 sec. 2026-10-30 10:11:14 02494_query_cache_eligible_queries: [ OK ] 0.42 sec. 2026-10-30 10:11:20 02494_query_cache_ttl_long: [ OK ] 6.34 sec. 2026-10-30 10:11:21 02494_query_cache_events: [ OK ] 0.52 sec. 2026-10-30 10:11:24 02494_trace_log_profile_events: [ OK ] 3.78 sec. 2026-10-30 10:11:25 02494_query_cache_bugs: [ OK ] 0.37 sec. 2026-10-30 10:11:25 02494_query_cache_squash_partial_results: [ OK ] 0.47 sec. 2026-10-30 10:11:26 02484_substitute_udf_storage_args: [ OK ] 0.37 sec. 2026-10-30 10:11:26 02483_check_virtuals_shile_using_structure_from_insertion_table: [ OK ] 0.32 sec. 2026-10-30 10:11:29 02483_capnp_decimals: [ OK ] 2.63 sec. 2026-10-30 10:11:31 02482_new_json_nested_arrays_with_same_keys: [ OK ] 2.23 sec. 2026-10-30 10:11:33 02482_json_nested_arrays_with_same_keys: [ OK ] 2.12 sec. 2026-10-30 10:11:36 02481_custom_separated_and_template_with_csv_field: [ OK ] 2.98 sec. 2026-10-30 10:11:39 02459_glob_for_recursive_directory_traversal: [ OK ] 2.93 sec. 2026-10-30 10:11:39 02458_hdfs_cluster_schema_inference: [ OK ] 0.42 sec. 2026-10-30 10:11:43 02440_mutations_finalization: [ OK ] 3.38 sec. 2026-10-30 10:11:43 02422_msgpack_uuid_wrong_column: [ OK ] 0.37 sec. 2026-10-30 10:11:43 02422_allow_implicit_no_password: [ SKIPPED ] 0.00 sec. 2026-10-30 10:11:43 Reason: not running for current build 2026-10-30 10:11:51 02421_record_errors_row_by_input_format: [ OK ] 7.49 sec. 2026-10-30 10:11:51 02411_merge_tree_zero_max_read_buffer_size: [ OK ] 0.32 sec. 2026-10-30 10:11:52 02404_schema_inference_cache_respect_format_settings: [ OK ] 0.57 sec. 2026-10-30 10:11:52 02397_system_parts_race_condition_drop_rm: [ SKIPPED ] 0.00 sec. 2026-10-30 10:11:52 Reason: disabled 2026-10-30 10:11:52 02396_system_parts_race_condition_rm: [ SKIPPED ] 0.00 sec. 2026-10-30 10:11:52 Reason: disabled 2026-10-30 10:11:52 02391_recursive_buffer: [ OK ] 0.42 sec. 2026-10-30 10:11:53 02385_profile_events_overflow: [ OK ] 0.37 sec. 2026-10-30 10:11:53 02376_arrow_dict_with_string: [ OK ] 0.32 sec. 2026-10-30 10:11:55 02373_heap_buffer_overflow_in_avro: [ OK ] 2.23 sec. 2026-10-30 10:12:18 02352_rwlock: [ OK ] 22.85 sec. 2026-10-30 10:12:19 02350_views_max_insert_threads: [ OK ] 0.62 sec. 2026-10-30 10:12:19 02346_additional_filters_distr: [ OK ] 0.32 sec. 2026-10-30 10:12:22 02337_drop_filesystem_cache_access: [ OK ] 2.88 sec. 2026-10-30 10:12:22 02323_null_modifier_in_table_function: [ OK ] 0.32 sec. 2026-10-30 10:12:23 02313_avro_records_and_maps: [ OK ] 0.37 sec. 2026-10-30 10:12:25 02311_system_zookeeper_insert_priv: [ OK ] 2.83 sec. 2026-10-30 10:12:26 02304_orc_arrow_parquet_string_as_string: [ OK ] 0.32 sec. 2026-10-30 10:12:39 02294_overcommit_overflow: [ OK ] 12.91 sec. 2026-10-30 10:13:04 02286_mysql_dump_input_format: [ OK ] 25.00 sec. 2026-10-30 10:13:07 02262_column_ttl: [ OK ] 3.03 sec. 2026-10-30 10:13:21 02247_written_bytes_quota: [ OK ] 13.72 sec. 2026-10-30 10:13:21 02244_lowcardinality_hash_join: [ OK ] 0.32 sec. 127.0.0.1 - - [30/Oct/2026:17:13:30 +0000] "PUT /devstoreaccount1/cont/qsifkiwszjmpushackzreydwxjbmjscc HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:13:31 +0000] "PUT /devstoreaccount1/cont/trhfbxydznxqirfwumiysqipthgovwwr HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:13:31 +0000] "PUT /devstoreaccount1/cont/rentcacfbhlyhlgjtemumjqvrkkqlcod HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:13:31 +0000] "PUT /devstoreaccount1/cont/mxjfmsuloomllsgfmtzwadfyadijarll HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:13:31 +0000] "PUT /devstoreaccount1/cont/vatkrnkcaievqctzilqcdmldjexxntuq HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:13:31 +0000] "PUT /devstoreaccount1/cont/gfugngsdxhjfpvznkamndzzvfpgavrba HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:13:31 +0000] "PUT /devstoreaccount1/cont/kvfuttleklqiejtusszzkimxdigkffow HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:13:31 +0000] "PUT /devstoreaccount1/cont/bfexreyyqqjzmprphwfbtxjwjrckazww HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:13:31 +0000] "PUT /devstoreaccount1/cont/odvzjdtdlawnsmntoousqlhznfexreqa HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:13:31 +0000] "PUT /devstoreaccount1/cont/mwfigxxxegrhrsrhjnmqglvskwaiuwoi HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:13:31 +0000] "GET /devstoreaccount1/cont/rentcacfbhlyhlgjtemumjqvrkkqlcod HTTP/1.1" 206 520 127.0.0.1 - - [30/Oct/2026:17:13:31 +0000] "GET /devstoreaccount1/cont/trhfbxydznxqirfwumiysqipthgovwwr HTTP/1.1" 206 808111 127.0.0.1 - - [30/Oct/2026:17:13:33 +0000] "DELETE /devstoreaccount1/cont/mwfigxxxegrhrsrhjnmqglvskwaiuwoi HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:13:33 +0000] "DELETE /devstoreaccount1/cont/kvfuttleklqiejtusszzkimxdigkffow HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:13:33 +0000] "DELETE /devstoreaccount1/cont/vatkrnkcaievqctzilqcdmldjexxntuq HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:13:33 +0000] "DELETE /devstoreaccount1/cont/trhfbxydznxqirfwumiysqipthgovwwr HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:13:33 +0000] "DELETE /devstoreaccount1/cont/rentcacfbhlyhlgjtemumjqvrkkqlcod HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:13:33 +0000] "DELETE /devstoreaccount1/cont/mxjfmsuloomllsgfmtzwadfyadijarll HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:13:33 +0000] "DELETE /devstoreaccount1/cont/gfugngsdxhjfpvznkamndzzvfpgavrba HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:13:33 +0000] "DELETE /devstoreaccount1/cont/odvzjdtdlawnsmntoousqlhznfexreqa HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:13:33 +0000] "DELETE /devstoreaccount1/cont/bfexreyyqqjzmprphwfbtxjwjrckazww HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:13:33 +0000] "DELETE /devstoreaccount1/cont/qsifkiwszjmpushackzreydwxjbmjscc HTTP/1.1" 202 - 2026-10-30 10:13:33 02242_system_filesystem_cache_log_table: [ OK ] 11.61 sec. 2026-10-30 10:13:45 02242_delete_user_race: [ OK ] 12.71 sec. 127.0.0.1 - - [30/Oct/2026:17:14:10 +0000] "PUT /devstoreaccount1/cont/xzxpsqvkipnjdaqvqzfifrcvgqphleny HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:11 +0000] "PUT /devstoreaccount1/cont/xzidhlegivyjfxwviaatinzsobmydhzf HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:11 +0000] "PUT /devstoreaccount1/cont/svygkvmfbnegtbldpunbufwwmaorjvwc HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:11 +0000] "PUT /devstoreaccount1/cont/eocenkremuvbwxjglkqqfmdcafujkeom HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:11 +0000] "PUT /devstoreaccount1/cont/gnotxdvinexbswciovhrltpaaojmkcgl HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:11 +0000] "PUT /devstoreaccount1/cont/ittxrlwskqvyskvbhejxukpbzkjikyjl HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:11 +0000] "PUT /devstoreaccount1/cont/zoigyxydemrgdtydstccigicokiovmfu HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:11 +0000] "PUT /devstoreaccount1/cont/bzbbsgnbvtewaejqnjqtmbynpsocefwy HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:11 +0000] "PUT /devstoreaccount1/cont/jbkyjeegbeaufirzpmmuaznmbxzeoolj HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:14 +0000] "PUT /devstoreaccount1/cont/ajsqqaalbkkipncuahtjffjpnvhjakry HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:14 +0000] "PUT /devstoreaccount1/cont/rwylfztnbxexzhodmpgpdmfzmvsqakrs HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:14 +0000] "PUT /devstoreaccount1/cont/jlnklshdpihkklkkpbrosyrsixwbonom HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:14 +0000] "PUT /devstoreaccount1/cont/dyhrwwfhxgfeqlykczrueiznpeeevwza HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:14 +0000] "PUT /devstoreaccount1/cont/ehlypykaqxpjiwlzizwusyeeeihpohor HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:14 +0000] "PUT /devstoreaccount1/cont/yvsfjjgjgpmivmohekfgjstmxmawuuzh HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:14 +0000] "PUT /devstoreaccount1/cont/rrsztitnsgfrjswlnwgilyyysdxzijwm HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:14 +0000] "PUT /devstoreaccount1/cont/kvhpdrqiblwkzubsczucageknwmxxdun HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/owfvrzldfqxliumsvwrevsylqcuizhxx HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/mmfzhjmuglejkltwxiajasttsjxwgagk HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/abstsncrlmsxxohtwtnlcgftvbwzfmru HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/cplgpxeunnyrzddmragfcpfasmgnckly HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/tddxkpjerxajavvcpjjbjpioocbznnvg HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/cdgzlgrnvhfogwophygrzyzlnknmwdib HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/fivbodusfacmcsoukbpjerzxlpzixsan HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/bwinqrcwvoiazirtcfztjisztvkelxci HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/igztwurgyakldrtxcdpmtcuyvfiwaloe HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/zneskfdotfyvvrqakvdyadhtalxngglt HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/hazbpwlbawlxyurkgklshiacmlmkfufw HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/poputrggvsiiidaqazscwjnslsvtzmlg HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/ocbinjlutvbopllabhcqrejbfpwbomnv HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/etzaujxrmzwfniwtenpynhoestnzhwta HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/ckeayjxoryldsdiujvsbmjdmgkoefqlq HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:16 +0000] "PUT /devstoreaccount1/cont/bqllzgwoiyymnoxshzlbsxunifhosrfn HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/clzebatpgfzhxtmoxngscuwsdfemqvlm HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/zlzcbrmjuigemrvbjeggavaaqyvqnrpd HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/hqqxwmpsfhojnfiyhsfpvgzdfxkfhjik HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/nsswtwugonuxeayayspdhzadvwpijbvl HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/enrfqrvrlnrkiqsooidpcuirvbbghryy HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/dkzhqaydkfyhsnxylutisibqbtlxmnpn HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/iaheuwotgdwbiinnxozfvojayfkgqtxc HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/fdrxqcncmhkkvcvrpzoxbnbutrwiauuy HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "GET /devstoreaccount1/cont/mmfzhjmuglejkltwxiajasttsjxwgagk HTTP/1.1" 206 80 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "GET /devstoreaccount1/cont/xzidhlegivyjfxwviaatinzsobmydhzf HTTP/1.1" 206 746 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "GET /devstoreaccount1/cont/owfvrzldfqxliumsvwrevsylqcuizhxx HTTP/1.1" 206 746 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/ypncvuwmwibvmgpwcrwjvibbrtotvkzx HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/fkqxzixgpugrjpolmeifbacwyxtfbfra HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/ngnnojxofawytxodwtkiyetbmlsdpqvp HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/pqatqfuipsqcgfcobtawwrbofwssslbl HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/pozukcihhorewirrhfbdeilhiujsjqmx HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/aecwxdckdhmhftqutqfssnpcerijlmbr HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/loyufrqacaxvfdysyyqvythbkarkywpq HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:17 +0000] "PUT /devstoreaccount1/cont/sdsalbntzmjixdyfqsbbzmseyyxtlwhf HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:18 +0000] "PUT /devstoreaccount1/cont/ugpnafwgwetfafxhwsyjdvjbkxxjtbvq HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:18 +0000] "PUT /devstoreaccount1/cont/wuoyecqqhajhkrodilkyfyptxgdcphkl HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:18 +0000] "PUT /devstoreaccount1/cont/ijbvovtwvcpunbkmkdofyyuvsfyaweqm HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:18 +0000] "PUT /devstoreaccount1/cont/hsvqvwafitiandietyhmlmspmwetlsmx HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:18 +0000] "PUT /devstoreaccount1/cont/zvjobpnsqarhwjwxyzpruhwxhxwvqgus HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:18 +0000] "PUT /devstoreaccount1/cont/qysllnlgeeugggkbhtukmhgoaryannva HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:18 +0000] "PUT /devstoreaccount1/cont/lzwuwmxmrilrofudecirpdrjgevgwlyo HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:18 +0000] "PUT /devstoreaccount1/cont/ofhslfiwxpbsrtjvhvfuvudvrqfzdign HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:18 +0000] "PUT /devstoreaccount1/cont/emfjvcijpjwhhsjpwvoqrcjzqunsvyiz HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/jyubfzebeaimjqaowrptiyemesyahhor HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/dcoukvrzxkeiaomyslrvurpivmjkrgqz HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/nfbqgpotxkwiwatlhejldhhwfnemyswq HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/xsstjdifnjvxyjfvucagrarqwhygbsav HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/bofenujlrucutqvuajyrwtkxokcdqozx HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/rpextgxmiuckbcvmdxyuxsgitknpsfay HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/peehotwwbszwfnyswlmaazjmhljjkrom HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/agrmihypjkjfuqwdgxqmmjszytgihuxo HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/mehqcalmjcsoqvhndtgdoohqthyblgql HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/whhtdyvzhgkmyirtkrwyrpisliuplemf HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/uxrofmlfumisdblsgznvifdstwmfzsme HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/kdgixtrktjiltixcclpsvibmkauqualh HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/eofnrszllxnpgbwciinpxyfupzvpynhj HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/nzyhysdtlckdcvstppmdrgfflcjeolxx HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/zlhwckyobgltyiuvvtjarespbcatjbxh HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/uglvnbdmcucqxdkinkcztwahlunohhmm HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/tbqzzlflamtlykvgvgffgehbxntkules HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/pikopdsmerkpnogqkdwbehpmgxygpoqy HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/xfgemrqhupxergyxelxepvnfgploidbl HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/dlodsudarqzbtctpftmtkxrlgbwgcxsw HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/xhnclqxakqxtzuailtwzfkgaboxllkyy HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/evydyaplnlscrtiesvkydmjiwmwwhiyh HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/acovzpwnvrlpjslqjdimqnbjzdtktgvy HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/bechifwhcgkihumtigeqgkxsqgzickmi HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/obtpefvwinyjahaqrigvekvxqdxpasob HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/jurswrokeotkgnqznfbyapddsinxmmnq HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/bwtjpiheqqehomzbyckvcglkwhvekewg HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/ortuqbkpcdurcydodbbxlzscdpynlexk HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/pzuybejgpjwwvsnzwqmvffndfqnvjhwv HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/fjpenbqrsljjqbqhgsorzdmitkdjqedm HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/eqbmrfjtobmwjmyaaysvtylcegrprzfr HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/vlulnjruzswqqlncabboyqxeyuhoaqju HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/jfdqnovnkiahfqriplukysmkmcktigvu HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/syuqmpxlqmtzololeudbzsbzmnakankr HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/pbxdrbnwkjwzjheovrsmkzgvcfwaazok HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/kbabxcyoxfaxvnezhulfwwcblqyqvqsj HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/iidmevainrgkbeoookvjaeuenrhudvjk HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/gdccchhlwqeaalfupnedgcclgdnzizzl HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/hvdtcvshebxpeaiyxpajlslguwvcasex HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/ffstoniuveeoftmingcvmlksgcgkzfoi HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/vwphvfeeqfaneysjbguifblckvwzhgoy HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/ntubpdmwinoocqnatlpzpxagkhtjppkc HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/bhlaglzbectronjkojyrftifsamvjyvr HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/puntibsqtwkkhialbdarhblcmlhqypjo HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/oxrjcfbrwavkkjewtpvricwfmstockzz HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/irzmomtolimgxtsblwbdpprncrslomso HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/clposfrqtpypueellqsxlbywsrkmfwdp HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/tcvfcvjrxvwhhbknjhulqpwautcwjokc HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/jlkcwursqqihflytddmpbsvmrtplzhyv HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:19 +0000] "PUT /devstoreaccount1/cont/ekfpwvdvqsssdrbktdpsfbnagpswqdsf HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:20 +0000] "PUT /devstoreaccount1/cont/xjpjaqyxvrhdtcdgacitcparpetcnriy HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:20 +0000] "PUT /devstoreaccount1/cont/saahmwhmxvotardvrrvzzgtcetpcqqlc HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:20 +0000] "PUT /devstoreaccount1/cont/taltqikkmnaqkclbnlykejyzivytyunm HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:20 +0000] "PUT /devstoreaccount1/cont/paabplgoarcfkkhxehccwfmprfmxowlf HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:20 +0000] "PUT /devstoreaccount1/cont/njrhonmeybdrmdbmptliagwqrfgspoox HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:20 +0000] "PUT /devstoreaccount1/cont/idlylisfuarpqynujqjmalgclqpbbyeq HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:20 +0000] "PUT /devstoreaccount1/cont/vmozzqadqbizjgpkuokclbmxguydnabn HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:20 +0000] "PUT /devstoreaccount1/cont/celaceupwouufrettihljupouqxotzvt HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:20 +0000] "PUT /devstoreaccount1/cont/ofveibykacahavtvnegtnimizahzqnml HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:20 +0000] "PUT /devstoreaccount1/cont/lbtlmjvcrumqkizbetgocnjnancjzrgf HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/jbkyjeegbeaufirzpmmuaznmbxzeoolj HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ittxrlwskqvyskvbhejxukpbzkjikyjl HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/gnotxdvinexbswciovhrltpaaojmkcgl HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/xzidhlegivyjfxwviaatinzsobmydhzf HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/svygkvmfbnegtbldpunbufwwmaorjvwc HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/eocenkremuvbwxjglkqqfmdcafujkeom HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/bzbbsgnbvtewaejqnjqtmbynpsocefwy HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/zoigyxydemrgdtydstccigicokiovmfu HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/sdsalbntzmjixdyfqsbbzmseyyxtlwhf HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/pozukcihhorewirrhfbdeilhiujsjqmx HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/pqatqfuipsqcgfcobtawwrbofwssslbl HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ypncvuwmwibvmgpwcrwjvibbrtotvkzx HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/fkqxzixgpugrjpolmeifbacwyxtfbfra HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ngnnojxofawytxodwtkiyetbmlsdpqvp HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/loyufrqacaxvfdysyyqvythbkarkywpq HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/aecwxdckdhmhftqutqfssnpcerijlmbr HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/emfjvcijpjwhhsjpwvoqrcjzqunsvyiz HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/qysllnlgeeugggkbhtukmhgoaryannva HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/zvjobpnsqarhwjwxyzpruhwxhxwvqgus HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/wuoyecqqhajhkrodilkyfyptxgdcphkl HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ijbvovtwvcpunbkmkdofyyuvsfyaweqm HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/hsvqvwafitiandietyhmlmspmwetlsmx HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ofhslfiwxpbsrtjvhvfuvudvrqfzdign HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/lzwuwmxmrilrofudecirpdrjgevgwlyo HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/lbtlmjvcrumqkizbetgocnjnancjzrgf HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/xjpjaqyxvrhdtcdgacitcparpetcnriy HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/idlylisfuarpqynujqjmalgclqpbbyeq HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/saahmwhmxvotardvrrvzzgtcetpcqqlc HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/vmozzqadqbizjgpkuokclbmxguydnabn HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/njrhonmeybdrmdbmptliagwqrfgspoox HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/taltqikkmnaqkclbnlykejyzivytyunm HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/paabplgoarcfkkhxehccwfmprfmxowlf HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ofveibykacahavtvnegtnimizahzqnml HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/celaceupwouufrettihljupouqxotzvt HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/kvhpdrqiblwkzubsczucageknwmxxdun HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ehlypykaqxpjiwlzizwusyeeeihpohor HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/dyhrwwfhxgfeqlykczrueiznpeeevwza HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ajsqqaalbkkipncuahtjffjpnvhjakry HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/rwylfztnbxexzhodmpgpdmfzmvsqakrs HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/jlnklshdpihkklkkpbrosyrsixwbonom HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/rrsztitnsgfrjswlnwgilyyysdxzijwm HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/yvsfjjgjgpmivmohekfgjstmxmawuuzh HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/bwinqrcwvoiazirtcfztjisztvkelxci HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/tddxkpjerxajavvcpjjbjpioocbznnvg HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/cplgpxeunnyrzddmragfcpfasmgnckly HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/owfvrzldfqxliumsvwrevsylqcuizhxx HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/mmfzhjmuglejkltwxiajasttsjxwgagk HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/abstsncrlmsxxohtwtnlcgftvbwzfmru HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/fivbodusfacmcsoukbpjerzxlpzixsan HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/cdgzlgrnvhfogwophygrzyzlnknmwdib HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/bqllzgwoiyymnoxshzlbsxunifhosrfn HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ocbinjlutvbopllabhcqrejbfpwbomnv HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/poputrggvsiiidaqazscwjnslsvtzmlg HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/igztwurgyakldrtxcdpmtcuyvfiwaloe HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/zneskfdotfyvvrqakvdyadhtalxngglt HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/hazbpwlbawlxyurkgklshiacmlmkfufw HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ckeayjxoryldsdiujvsbmjdmgkoefqlq HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/etzaujxrmzwfniwtenpynhoestnzhwta HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/fdrxqcncmhkkvcvrpzoxbnbutrwiauuy HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/enrfqrvrlnrkiqsooidpcuirvbbghryy HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/nsswtwugonuxeayayspdhzadvwpijbvl HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/clzebatpgfzhxtmoxngscuwsdfemqvlm HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/zlzcbrmjuigemrvbjeggavaaqyvqnrpd HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/hqqxwmpsfhojnfiyhsfpvgzdfxkfhjik HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/iaheuwotgdwbiinnxozfvojayfkgqtxc HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/dkzhqaydkfyhsnxylutisibqbtlxmnpn HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/whhtdyvzhgkmyirtkrwyrpisliuplemf HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/jyubfzebeaimjqaowrptiyemesyahhor HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/rpextgxmiuckbcvmdxyuxsgitknpsfay HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/dcoukvrzxkeiaomyslrvurpivmjkrgqz HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/peehotwwbszwfnyswlmaazjmhljjkrom HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/bofenujlrucutqvuajyrwtkxokcdqozx HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/nfbqgpotxkwiwatlhejldhhwfnemyswq HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/xsstjdifnjvxyjfvucagrarqwhygbsav HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/mehqcalmjcsoqvhndtgdoohqthyblgql HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/agrmihypjkjfuqwdgxqmmjszytgihuxo HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/dlodsudarqzbtctpftmtkxrlgbwgcxsw HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/uxrofmlfumisdblsgznvifdstwmfzsme HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/uglvnbdmcucqxdkinkcztwahlunohhmm HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/kdgixtrktjiltixcclpsvibmkauqualh HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/tbqzzlflamtlykvgvgffgehbxntkules HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/zlhwckyobgltyiuvvtjarespbcatjbxh HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/eofnrszllxnpgbwciinpxyfupzvpynhj HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/nzyhysdtlckdcvstppmdrgfflcjeolxx HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/xfgemrqhupxergyxelxepvnfgploidbl HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/pikopdsmerkpnogqkdwbehpmgxygpoqy HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/fjpenbqrsljjqbqhgsorzdmitkdjqedm HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/xhnclqxakqxtzuailtwzfkgaboxllkyy HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/jurswrokeotkgnqznfbyapddsinxmmnq HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/evydyaplnlscrtiesvkydmjiwmwwhiyh HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/bwtjpiheqqehomzbyckvcglkwhvekewg HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/obtpefvwinyjahaqrigvekvxqdxpasob HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/acovzpwnvrlpjslqjdimqnbjzdtktgvy HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/bechifwhcgkihumtigeqgkxsqgzickmi HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/pzuybejgpjwwvsnzwqmvffndfqnvjhwv HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ortuqbkpcdurcydodbbxlzscdpynlexk HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ffstoniuveeoftmingcvmlksgcgkzfoi HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/eqbmrfjtobmwjmyaaysvtylcegrprzfr HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/kbabxcyoxfaxvnezhulfwwcblqyqvqsj HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/vlulnjruzswqqlncabboyqxeyuhoaqju HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/iidmevainrgkbeoookvjaeuenrhudvjk HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/pbxdrbnwkjwzjheovrsmkzgvcfwaazok HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/jfdqnovnkiahfqriplukysmkmcktigvu HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/syuqmpxlqmtzololeudbzsbzmnakankr HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/hvdtcvshebxpeaiyxpajlslguwvcasex HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/gdccchhlwqeaalfupnedgcclgdnzizzl HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ekfpwvdvqsssdrbktdpsfbnagpswqdsf HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/vwphvfeeqfaneysjbguifblckvwzhgoy HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/irzmomtolimgxtsblwbdpprncrslomso HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ntubpdmwinoocqnatlpzpxagkhtjppkc HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/clposfrqtpypueellqsxlbywsrkmfwdp HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/oxrjcfbrwavkkjewtpvricwfmstockzz HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/bhlaglzbectronjkojyrftifsamvjyvr HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/puntibsqtwkkhialbdarhblcmlhqypjo HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/jlkcwursqqihflytddmpbsvmrtplzhyv HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/tcvfcvjrxvwhhbknjhulqpwautcwjokc HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/xzxpsqvkipnjdaqvqzfifrcvgqphleny HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:21 +0000] "DELETE /devstoreaccount1/cont/ugpnafwgwetfafxhwsyjdvjbkxxjtbvq HTTP/1.1" 202 - 2026-10-30 10:14:21 02241_filesystem_cache_on_write_operations: [ OK ] 35.48 sec. 2026-10-30 10:14:22 02240_filesystem_cache_bypass_cache_threshold: [ OK ] 0.42 sec. 2026-10-30 10:14:22 02240_filesystem_query_cache: [ OK ] 0.42 sec. 127.0.0.1 - - [30/Oct/2026:17:14:36 +0000] "PUT /devstoreaccount1/cont/xqwrxheguhjihnvvwjdhmdpszrtjnklm HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:36 +0000] "PUT /devstoreaccount1/cont/nbdwjhwtrpxsgnouubmgvyflxsuwoawe HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:36 +0000] "PUT /devstoreaccount1/cont/opnhxmbxrcpybhbhqqnjxgnnuqfzggac HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:36 +0000] "PUT /devstoreaccount1/cont/hlsfwbcxjxcotxvacxbmxapptoqcdhze HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:36 +0000] "PUT /devstoreaccount1/cont/abfnzshidndnwkndyaphosglsbztnedr HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:36 +0000] "PUT /devstoreaccount1/cont/dnwuzmphqpwrzvbitjaytlklqstddqhw HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:36 +0000] "PUT /devstoreaccount1/cont/osufuzyyaquglvmppfxbgdglvkehcmgh HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:36 +0000] "PUT /devstoreaccount1/cont/yfukywjjvrpdkznpwtejcdbidqjvcyjv HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:36 +0000] "PUT /devstoreaccount1/cont/epsicnmblydylgbslijwnfitumjclhen HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:36 +0000] "PUT /devstoreaccount1/cont/dsjwgvlimrkdbmsvjoiouoibnuzhzklq HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:37 +0000] "GET /devstoreaccount1/cont/opnhxmbxrcpybhbhqqnjxgnnuqfzggac HTTP/1.1" 206 80 127.0.0.1 - - [30/Oct/2026:17:14:37 +0000] "GET /devstoreaccount1/cont/nbdwjhwtrpxsgnouubmgvyflxsuwoawe HTTP/1.1" 206 746 127.0.0.1 - - [30/Oct/2026:17:14:39 +0000] "GET /devstoreaccount1/cont/opnhxmbxrcpybhbhqqnjxgnnuqfzggac HTTP/1.1" 206 80 127.0.0.1 - - [30/Oct/2026:17:14:39 +0000] "GET /devstoreaccount1/cont/nbdwjhwtrpxsgnouubmgvyflxsuwoawe HTTP/1.1" 206 746 127.0.0.1 - - [30/Oct/2026:17:14:40 +0000] "DELETE /devstoreaccount1/cont/dsjwgvlimrkdbmsvjoiouoibnuzhzklq HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:40 +0000] "DELETE /devstoreaccount1/cont/osufuzyyaquglvmppfxbgdglvkehcmgh HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:40 +0000] "DELETE /devstoreaccount1/cont/abfnzshidndnwkndyaphosglsbztnedr HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:40 +0000] "DELETE /devstoreaccount1/cont/nbdwjhwtrpxsgnouubmgvyflxsuwoawe HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:40 +0000] "DELETE /devstoreaccount1/cont/opnhxmbxrcpybhbhqqnjxgnnuqfzggac HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:40 +0000] "DELETE /devstoreaccount1/cont/hlsfwbcxjxcotxvacxbmxapptoqcdhze HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:40 +0000] "DELETE /devstoreaccount1/cont/dnwuzmphqpwrzvbitjaytlklqstddqhw HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:40 +0000] "DELETE /devstoreaccount1/cont/epsicnmblydylgbslijwnfitumjclhen HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:40 +0000] "DELETE /devstoreaccount1/cont/yfukywjjvrpdkznpwtejcdbidqjvcyjv HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:40 +0000] "DELETE /devstoreaccount1/cont/xqwrxheguhjihnvvwjdhmdpszrtjnklm HTTP/1.1" 202 - 2026-10-30 10:14:40 02240_system_filesystem_cache_table: [ OK ] 17.98 sec. 2026-10-30 10:14:40 02232_dist_insert_send_logs_level_hung: [ SKIPPED ] 0.00 sec. 2026-10-30 10:14:40 Reason: disabled 2026-10-30 10:14:43 02227_test_create_empty_sqlite_db: [ OK ] 2.68 sec. 127.0.0.1 - - [30/Oct/2026:17:14:51 +0000] "PUT /devstoreaccount1/cont/mngjdhfeuhziwqunjsukrgunbcsvczwx HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:51 +0000] "PUT /devstoreaccount1/cont/yqsoccdillqejnnjqlshebbohybtagsw HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:51 +0000] "PUT /devstoreaccount1/cont/bpfdxdikefvuvogpcnianiyqcpgwaqbn HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:51 +0000] "PUT /devstoreaccount1/cont/uxsfwmqbdwspihbobomsecpzlwccqswl HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:51 +0000] "PUT /devstoreaccount1/cont/soognlbmztfgmactqrbsyofnesdlsjqp HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:51 +0000] "PUT /devstoreaccount1/cont/xxgjxqkmezhfsxolsneirasggcumwyqi HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:51 +0000] "PUT /devstoreaccount1/cont/kttqvenhsimnywvmdwjrsqvryrutlxey HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:51 +0000] "PUT /devstoreaccount1/cont/bexdngongkdbblmvyksbjuuydfllbuot HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:51 +0000] "PUT /devstoreaccount1/cont/vfmjijfubiespfoatletgbevjmbscsrw HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:51 +0000] "PUT /devstoreaccount1/cont/yymdasaefpambnfnrmyunlakyfptmuok HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:52 +0000] "GET /devstoreaccount1/cont/bpfdxdikefvuvogpcnianiyqcpgwaqbn HTTP/1.1" 206 62 127.0.0.1 - - [30/Oct/2026:17:14:52 +0000] "GET /devstoreaccount1/cont/yqsoccdillqejnnjqlshebbohybtagsw HTTP/1.1" 206 100577 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/scpoyigmgnqeyrtavqurtzokgobvtaqh HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/xpcxxdiyuvivxcmcgravcwvizzegldta HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/qyqrsvedosqrlixywtkydxhgbhssfkqu HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/knxxcngqgnbliipxfzsnxeqixnhhbicn HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/xinbhaaltuchmcywvphawwhaaklpawiw HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/yymdasaefpambnfnrmyunlakyfptmuok HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/kttqvenhsimnywvmdwjrsqvryrutlxey HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/soognlbmztfgmactqrbsyofnesdlsjqp HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/bpfdxdikefvuvogpcnianiyqcpgwaqbn HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/yqsoccdillqejnnjqlshebbohybtagsw HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/uxsfwmqbdwspihbobomsecpzlwccqswl HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/xxgjxqkmezhfsxolsneirasggcumwyqi HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/vfmjijfubiespfoatletgbevjmbscsrw HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/bexdngongkdbblmvyksbjuuydfllbuot HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/pgpjpfqsxbxevsbpehhugqljsuneebkk HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/qmlkpchnjereqpuvcqugjvkzobhcgteg HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/vmzfkramzzisxvyvqkbpupaxysjwpthl HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/cilpfjwwxpppyjtsizgpeznnkqicgxfr HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/johghzjgvlykbgjjivpeytqjzjokceqc HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/bxxwhhvthnguycbdivjiiohjxlwsjcbz HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/mtreshmarcvlgwkttrthjsnmnhrqovla HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/okmzbwmhzvutunrwvstcklppszewcxoh HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "PUT /devstoreaccount1/cont/frhccjrhwieuhzemifoxkdvqcgiaqzkm HTTP/1.1" 201 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/xinbhaaltuchmcywvphawwhaaklpawiw HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/xpcxxdiyuvivxcmcgravcwvizzegldta HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/scpoyigmgnqeyrtavqurtzokgobvtaqh HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/ddivuxiebdjfhkgmouhbtgcxxyhqsrud HTTP/1.1" 404 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/gapfxvixslcbqncvbfawwrbparzykqmo HTTP/1.1" 404 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/tvtbchnhxsllwnsafcjibagcvnplinol HTTP/1.1" 404 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/knxxcngqgnbliipxfzsnxeqixnhhbicn HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/qyqrsvedosqrlixywtkydxhgbhssfkqu HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/frhccjrhwieuhzemifoxkdvqcgiaqzkm HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/bxxwhhvthnguycbdivjiiohjxlwsjcbz HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/cilpfjwwxpppyjtsizgpeznnkqicgxfr HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/qmlkpchnjereqpuvcqugjvkzobhcgteg HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/pgpjpfqsxbxevsbpehhugqljsuneebkk HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/vmzfkramzzisxvyvqkbpupaxysjwpthl HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/johghzjgvlykbgjjivpeytqjzjokceqc HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/okmzbwmhzvutunrwvstcklppszewcxoh HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/mtreshmarcvlgwkttrthjsnmnhrqovla HTTP/1.1" 202 - 127.0.0.1 - - [30/Oct/2026:17:14:54 +0000] "DELETE /devstoreaccount1/cont/mngjdhfeuhziwqunjsukrgunbcsvczwx HTTP/1.1" 202 - 2026-10-30 10:14:54 02226_filesystem_cache_profile_events: [ OK ] 11.61 sec. 2026-10-30 10:14:57 02225_unwinder_dwarf_version: [ OK ] 2.23 sec. 2026-10-30 10:15:02 02222_create_table_without_columns_metadata: [ OK ] 5.64 sec. 2026-10-30 10:15:07 02207_allow_plaintext_and_no_password: [ OK ] 5.09 sec. 2026-10-30 10:15:11 02185_values_schema_inference: [ OK ] 3.13 sec. 2026-10-30 10:15:13 02184_ipv6_parsing: [ OK ] 2.42 sec. 2026-10-30 10:15:16 02182_json_each_row_schema_inference: [ OK ] 2.53 sec. 2026-10-30 10:15:16 02179_dict_reload_on_cluster: [ OK ] 0.47 sec. 2026-10-30 10:15:18 02177_temporary_table_current_database_http_session: [ OK ] 2.03 sec. 2026-10-30 10:15:18 02168_avro_bug: [ OK ] 0.37 sec. 2026-10-30 10:15:21 02166_arrow_dictionary_inference: [ OK ] 2.33 sec. 2026-10-30 10:15:21 02155_multiple_inserts_for_formats_with_suffix: [ OK ] 0.42 sec. 2026-10-30 10:15:22 02148_sql_user_defined_function_subquery: [ OK ] 0.37 sec. 2026-10-30 10:15:22 02126_identity_user_defined_function: [ OK ] 0.37 sec. 2026-10-30 10:15:22 02125_recursive_sql_user_defined_functions: [ OK ] 0.42 sec. 2026-10-30 10:15:22 02125_many_mutations_2: [ SKIPPED ] 0.00 sec. 2026-10-30 10:15:22 Reason: not running for current build 2026-10-30 10:15:25 02105_table_function_file_partiotion_by: [ OK ] 2.98 sec. 2026-10-30 10:15:28 02104_json_strings_nullable_string: [ OK ] 2.43 sec. 2026-10-30 10:15:28 02103_sql_user_defined_functions_composition: [ OK ] 0.32 sec. 2026-10-30 10:15:40 02103_tsv_csv_custom_null_representation: [ OK ] 12.16 sec. 2026-10-30 10:15:41 02101_sql_user_defined_functions_drop_if_exists: [ OK ] 0.32 sec. 2026-10-30 10:15:41 02098_sql_user_defined_functions_aliases: [ OK ] 0.32 sec. 2026-10-30 10:15:41 02096_sql_user_defined_function_alias: [ OK ] 0.27 sec. 2026-10-30 10:15:42 02096_rename_atomic_hang: [ OK ] 0.42 sec. 2026-10-30 10:15:43 02051_read_settings: [ OK ] 1.48 sec. 2026-10-30 10:15:44 02028_add_default_database_for_alterquery_on_cluster: [ OK ] 0.77 sec. 2026-10-30 10:15:54 02026_storage_filelog_largefile: [ OK ] 10.25 sec. 2026-10-30 10:15:55 02025_dictionary_view_different_db: [ OK ] 0.42 sec. 2026-10-30 10:15:55 02015_column_default_dict_get_identifier: [ OK ] 0.42 sec. 2026-10-30 10:15:58 02015_global_in_threads: [ OK ] 2.93 sec. 2026-10-30 10:15:59 02011_dictionary_empty_attribute_list: [ OK ] 0.32 sec. 2026-10-30 10:15:59 01999_grant_with_replace: [ OK ] 0.42 sec. 2026-10-30 10:15:59 01948_dictionary_quoted_database_name: [ OK ] 0.37 sec. 2026-10-30 10:16:00 01915_create_or_replace_dictionary: [ OK ] 0.37 sec. 2026-10-30 10:16:00 01913_exact_rows_before_limit_full: [ OK ] 0.47 sec. 2026-10-30 10:16:01 01910_view_dictionary: [ OK ] 0.42 sec. 2026-10-30 10:16:03 01903_ssd_cache_dictionary_array_type: [ OK ] 2.23 sec. 2026-10-30 10:16:04 01902_table_function_merge_db_repr: [ OK ] 0.52 sec. 2026-10-30 10:16:05 01901_test_attach_partition_from: [ OK ] 1.02 sec. 2026-10-30 10:16:07 01889_postgresql_protocol_null_fields: [ OK ] 2.23 sec. 2026-10-30 10:16:07 01870_buffer_flush: [ OK ] 0.32 sec. 2026-10-30 10:16:08 01856_create_function: [ OK ] 0.42 sec. 2026-10-30 10:16:11 01853_dictionary_cache_duplicates: [ OK ] 3.03 sec. 2026-10-30 10:16:11 01850_dist_INSERT_preserve_error: [ OK ] 0.42 sec. 2026-10-30 10:16:12 01837_database_memory_ddl_dictionaries: [ OK ] 0.37 sec. 2026-10-30 10:16:12 01821_table_comment: [ OK ] 0.47 sec. 2026-10-30 10:16:13 01785_dictionary_element_count: [ OK ] 0.47 sec. 2026-10-30 10:16:13 01778_hierarchical_dictionaries: [ OK ] 0.52 sec. 2026-10-30 10:16:14 01754_direct_dictionary_complex_key: [ OK ] 0.62 sec. 2026-10-30 10:16:14 01753_direct_dictionary_simple_key: [ OK ] 0.67 sec. 2026-10-30 10:16:15 01747_executable_pool_dictionary_implicit_key: [ OK ] 1.02 sec. 2026-10-30 10:16:17 01746_executable_pool_dictionary: [ OK ] 1.07 sec. 2026-10-30 10:16:20 01737_clickhouse_server_wait_server_pool_long: [ OK ] 3.83 sec. 2026-10-30 10:16:23 01722_long_brotli_http_compression_json_format: [ OK ] 2.63 sec. 2026-10-30 10:16:23 01721_engine_file_truncate_on_insert: [ OK ] 0.32 sec. 2026-10-30 10:16:28 01710_projection_vertical_merges: [ OK ] 4.53 sec. 2026-10-30 10:16:29 01681_cache_dictionary_simple_key: [ OK ] 0.62 sec. 2026-10-30 10:16:29 01676_dictget_in_default_expression: [ OK ] 0.47 sec. 2026-10-30 10:16:30 01670_dictionary_create_key_expression: [ OK ] 0.43 sec. 2026-10-30 10:16:30 01646_system_restart_replicas_smoke: [ OK ] 0.42 sec. 2026-10-30 10:16:31 01643_replicated_merge_tree_fsync_smoke: [ OK ] 1.38 sec. 2026-10-30 10:16:32 01615_random_one_shard_insertion: [ OK ] 0.52 sec. 2026-10-30 10:16:32 01603_rename_overwrite_bug: [ OK ] 0.42 sec. 2026-10-30 10:17:00 01600_detach_permanently: [ OK ] 27.76 sec. 2026-10-30 10:17:50 01593_concurrent_alter_mutations_kill_many_replicas_long: [ OK ] 49.48 sec. 2026-10-30 10:17:50 01575_disable_detach_table_of_dictionary: [ OK ] 0.32 sec. 2026-10-30 10:17:51 01530_drop_database_atomic_sync: [ OK ] 0.62 sec. 2026-10-30 10:17:53 01527_clickhouse_local_optimize: [ OK ] 2.28 sec. 2026-10-30 10:17:53 01526_complex_key_dict_direct_layout: [ OK ] 0.37 sec. 2026-10-30 10:17:54 01524_do_not_merge_across_partitions_select_final: [ OK ] 0.97 sec. 2026-10-30 10:17:55 01517_drop_mv_with_inner_table: [ OK ] 0.42 sec. 2026-10-30 10:17:59 01507_clickhouse_server_start_with_embedded_config: [ OK ] 3.83 sec. 2026-10-30 10:18:00 01501_cache_dictionary_all_fields: [ OK ] 1.07 sec. 2026-10-30 10:18:02 01474_executable_dictionary: [ OK ] 2.73 sec. 2026-10-30 10:18:03 01471_calculate_ttl_during_merge: [ OK ] 0.47 sec. 2026-10-30 10:18:18 01459_manual_write_to_replicas_quorum_detach_attach: [ OK ] 15.57 sec. 2026-10-30 10:18:55 01459_manual_write_to_replicas: [ OK ] 36.63 sec. 2026-10-30 10:18:56 01457_create_as_table_function_structure: [ OK ] 0.42 sec. 2026-10-30 10:18:56 01455_rank_correlation_spearman: [ OK ] 0.37 sec. 2026-10-30 10:19:18 01454_storagememory_data_race_challenge: [ OK ] 21.99 sec. 2026-10-30 10:19:23 01417_freeze_partition_verbose_zookeeper: [ OK ] 5.03 sec. 2026-10-30 10:19:31 01417_freeze_partition_verbose: [ OK ] 7.90 sec. 2026-10-30 10:20:16 01414_mutations_and_errors_zookeeper: [ OK ] 45.37 sec. 2026-10-30 10:20:20 01410_nullable_key_more_tests: [ OK ] 3.43 sec. 2026-10-30 10:20:28 01375_storage_file_tsv_csv_with_names_write_prefix: [ OK ] 8.65 sec. 2026-10-30 10:20:30 01360_materialized_view_with_join_on_query_log: [ OK ] 1.83 sec. 2026-10-30 10:20:31 01356_view_threads: [ OK ] 0.42 sec. 2026-10-30 10:20:43 01320_create_sync_race_condition_zookeeper: [ OK ] 12.21 sec. 2026-10-30 10:20:48 01307_multiple_leaders_zookeeper: [ OK ] 5.44 sec. 2026-10-30 10:21:01 01305_replica_create_drop_zookeeper: [ OK ] 12.41 sec. 2026-10-30 10:21:35 01301_aggregate_state_exception_memory_leak: [ OK ] 34.33 sec. 2026-10-30 10:21:36 01297_create_quota: [ OK ] 0.82 sec. 2026-10-30 10:21:37 01295_create_row_policy: [ OK ] 0.42 sec. 2026-10-30 10:21:37 01294_system_distributed_on_cluster: [ OK ] 0.52 sec. 2026-10-30 10:21:38 01294_create_settings_profile: [ OK ] 0.47 sec. 2026-10-30 10:21:38 01293_system_distribution_queue: [ OK ] 0.37 sec. 2026-10-30 10:21:38 01281_unsucceeded_insert_select_queries_counter: [ OK ] 0.42 sec. 2026-10-30 10:21:45 01281_group_by_limit_memory_tracking: [ OK ] 6.29 sec. 2026-10-30 10:21:49 01280_ssd_complex_key_dictionary: [ OK ] 3.93 sec. 2026-10-30 10:22:47 01275_parallel_mv: [ OK ] 58.01 sec. 2026-10-30 10:22:47 01251_dict_is_in_infinite_loop: [ OK ] 0.57 sec. 2026-10-30 10:22:48 01225_show_create_table_from_dictionary: [ OK ] 0.37 sec. 2026-10-30 10:23:25 01192_rename_database_zookeeper: [ OK ] 36.84 sec. 2026-10-30 10:23:25 01164_alter_memory_database: [ OK ] 0.47 sec. 2026-10-30 10:23:26 01155_rename_move_materialized_view: [ OK ] 0.72 sec. 2026-10-30 10:24:25 01154_move_partition_long: [ OK ] 59.26 sec. 2026-10-30 10:24:26 01153_attach_mv_uuid: [ OK ] 0.57 sec. 2026-10-30 10:24:27 01148_zookeeper_path_macros_unfolding: [ OK ] 1.02 sec. 2026-10-30 10:24:27 01119_weird_user_names: [ OK ] 0.42 sec. 2026-10-30 10:24:59 01111_create_drop_replicated_db_stress: [ OK ] 31.67 sec. 2026-10-30 10:24:59 01110_dictionary_layout_without_arguments: [ OK ] 0.37 sec. 2026-10-30 10:25:00 01103_distributed_product_mode_local_column_renames: [ OK ] 0.52 sec. 2026-10-30 10:25:08 01098_temporary_and_external_tables: [ OK ] 8.30 sec. 2026-10-30 10:25:09 01091_num_threads: [ OK ] 0.52 sec. 2026-10-30 10:25:12 01085_max_distributed_connections_http: [ OK ] 2.93 sec. 2026-10-30 10:25:44 01083_expressions_in_engine_arguments: [ OK ] 32.73 sec. 2026-10-30 10:25:46 01082_window_view_watch_limit: [ OK ] 1.22 sec. 2026-10-30 10:26:13 01079_parallel_alter_detach_table_zookeeper: [ OK ] 27.56 sec. 2026-10-30 10:26:21 01076_cache_dictionary_datarace_exception_ptr: [ OK ] 8.20 sec. 2026-10-30 10:26:22 01075_allowed_client_hosts: [ OK ] 0.37 sec. 2026-10-30 10:26:26 01075_window_view_proc_tumble_to_now_populate: [ OK ] 4.18 sec. 2026-10-30 10:26:27 01070_materialize_ttl: [ OK ] 0.72 sec. 2026-10-30 10:26:27 01070_mutations_with_dependencies: [ OK ] 0.57 sec. 2026-10-30 10:26:28 01070_modify_ttl: [ OK ] 0.67 sec. 2026-10-30 10:26:37 01069_window_view_proc_tumble_watch: [ OK ] 8.55 sec. 2026-10-30 10:26:38 01065_window_view_event_hop_watch_bounded: [ OK ] 1.43 sec. 2026-10-30 10:26:39 01060_shutdown_table_after_detach: [ OK ] 1.12 sec. 2026-10-30 10:26:46 01055_window_view_proc_hop_to: [ OK ] 7.19 sec. 2026-10-30 10:26:50 01053_ssd_dictionary: [ OK ] 3.48 sec. 2026-10-30 10:26:58 01038_dictionary_lifetime_min_zero_sec: [ OK ] 7.70 sec. 2026-10-30 10:26:58 01036_no_superfluous_dict_reload_on_create_database: [ OK ] 0.42 sec. 2026-10-30 10:26:59 01036_no_superfluous_dict_reload_on_create_database_2: [ OK ] 0.47 sec. 2026-10-30 10:26:59 01023_materialized_view_query_context: [ OK ] 0.42 sec. 2026-10-30 10:27:12 01018_ddl_dictionaries_concurrent_requrests: [ OK ] 13.32 sec. 2026-10-30 10:27:17 01018_ddl_dictionaries_bad_queries: [ OK ] 4.53 sec. 2026-10-30 10:27:41 01014_lazy_database_concurrent_recreate_reattach_and_show_tables: [ OK ] 24.39 sec. 2026-10-30 10:27:58 01014_lazy_database_basic: [ OK ] 16.83 sec. 2026-10-30 10:28:02 01013_sync_replica_timeout_zookeeper: [ OK ] 3.88 sec. 2026-10-30 10:28:15 01007_r1r2_w_r2r1_deadlock: [ OK ] 13.41 sec. 2026-10-30 10:28:30 01004_rename_deadlock: [ OK ] 14.47 sec. 2026-10-30 10:28:31 00985_merge_stack_overflow: [ OK ] 0.57 sec. 2026-10-30 10:28:33 00971_query_id_in_logs: [ OK ] 2.23 sec. 2026-10-30 10:28:33 00963_achimbab: [ OK ] 0.40 sec. 2026-10-30 10:28:34 00950_dict_get: [ OK ] 0.67 sec. 2026-10-30 10:28:36 00877_memory_limit_for_new_delete: [ OK ] 1.97 sec. 2026-10-30 10:29:08 00840_long_concurrent_select_and_drop_deadlock: [ OK ] 31.92 sec. 2026-10-30 10:29:08 00722_inner_join: [ OK ] 0.42 sec. 2026-10-30 10:29:09 00693_max_block_size_system_tables_columns: [ OK ] 0.42 sec. 2026-10-30 10:29:14 00623_truncate_table_throw_exception: [ OK ] 5.04 sec. 2026-10-30 10:29:15 00510_materizlized_view_and_deduplication_zookeeper: [ OK ] 0.87 sec. 2026-10-30 10:29:25 00463_long_sessions_in_http_interface: [ OK ] 10.00 sec. 2026-10-30 10:29:25 00332_quantile_timing_memory_leak: [ OK ] 0.32 sec. 2026-10-30 10:29:25 00309_formats_case_insensitive: [ OK ] 0.37 sec. 2026-10-30 10:29:25 00002_log_and_exception_messages_formatting: [ SKIPPED ] 0.00 sec. 2026-10-30 10:29:25 Reason: skip 2026-10-30 10:29:25 2026-10-30 10:29:25 273 tests passed. 9 tests skipped. 1620.67 s elapsed (MainProcess). 2026-10-30 10:29:26 Won't run stateful tests because test data wasn't loaded. 2026-10-30 10:29:26 Checking the hung queries: done 2026-10-30 10:29:26 2026-10-30 10:29:26 No queries hung. 2026-10-30 10:29:26 2026-10-30 10:29:26 Some tests were restarted: 2026-10-30 10:29:26 2026-10-30 10:29:26 2026-10-30 10:29:26 02221_parallel_replicas_bug : 2026-10-30 10:29:26 [ fail ] 3.03 sec. 2026-10-30 10:29:26 Reason: having stderror: 2026-10-30 10:29:26 [517c299cba99] 2026.10.30 18:53:19.529151 [ 21011 ] {7b3d6726-0d00-4ff8-b8e3-dd2fdab3162b} ConnectionPoolWithFailover: Connection failed at try №1, reason: Code: 210. DB::NetException: Connection refused (127.0.0.3:1234). (NETWORK_ERROR) (version 24.8.14.10550.altinitytest (altinity build)) 2026-10-30 10:29:26 2026-10-30 10:29:26 stdout: 2026-10-30 10:29:26 2026-10-30 10:29:26 2026-10-30 10:29:26 Settings used in the test: --max_insert_threads 3 --group_by_two_level_threshold 1000000 --group_by_two_level_threshold_bytes 50000000 --distributed_aggregation_memory_efficient 1 --fsync_metadata 1 --output_format_parallel_formatting 1 --input_format_parallel_parsing 0 --min_chunk_bytes_for_parallel_parsing 14426821 --max_read_buffer_size 710819 --prefer_localhost_replica 1 --max_block_size 23989 --max_joined_block_size_rows 21768 --max_threads 3 --optimize_append_index 0 --optimize_if_chain_to_multiif 0 --optimize_if_transform_strings_to_enum 1 --optimize_read_in_order 1 --optimize_or_like_chain 0 --optimize_substitute_columns 1 --enable_multiple_prewhere_read_steps 1 --read_in_order_two_level_merge_threshold 49 --optimize_aggregation_in_order 0 --aggregation_in_order_max_block_bytes 10211613 --use_uncompressed_cache 1 --min_bytes_to_use_direct_io 10737418240 --min_bytes_to_use_mmap_io 10737418240 --local_filesystem_read_method io_uring --remote_filesystem_read_method read --local_filesystem_read_prefetch 0 --filesystem_cache_segments_batch_size 3 --read_from_filesystem_cache_if_exists_otherwise_bypass_cache 1 --throw_on_error_from_cache_on_write_operations 1 --remote_filesystem_read_prefetch 1 --allow_prefetched_read_pool_for_remote_filesystem 0 --filesystem_prefetch_max_memory_usage 64Mi --filesystem_prefetches_limit 10 --filesystem_prefetch_min_bytes_for_single_read_task 1Mi --filesystem_prefetch_step_marks 50 --filesystem_prefetch_step_bytes 0 --compile_aggregate_expressions 1 --compile_sort_description 0 --merge_tree_coarse_index_granularity 8 --optimize_distinct_in_order 0 --max_bytes_before_external_sort 10737418240 --max_bytes_before_external_group_by 10737418240 --max_bytes_before_remerge_sort 1348895913 --min_compress_block_size 1267118 --max_compress_block_size 1181019 --merge_tree_compact_parts_min_granules_to_multibuffer_read 32 --optimize_sorting_by_input_stream_properties 0 --http_response_buffer_size 1097066 --http_wait_end_of_query True --enable_memory_bound_merging_of_aggregation_results 1 --min_count_to_compile_expression 0 --min_count_to_compile_aggregate_expression 0 --min_count_to_compile_sort_description 3 --session_timezone Africa/Juba --use_page_cache_for_disks_without_file_cache False --page_cache_inject_eviction False --merge_tree_read_split_ranges_into_intersecting_and_non_intersecting_injection_probability 0.54 --prefer_external_sort_block_bytes 100000000 --cross_join_min_rows_to_compress 1 --cross_join_min_bytes_to_compress 1 --min_external_table_block_size_bytes 100000000 --max_parsing_threads 0 --optimize_functions_to_subcolumns 0 --parallel_replicas_local_plan 0 2026-10-30 10:29:26 2026-10-30 10:29:26 MergeTree settings used in test: --ratio_of_defaults_for_sparse_serialization 1.0 --prefer_fetch_merged_part_size_threshold 10737418240 --vertical_merge_algorithm_min_rows_to_activate 1 --vertical_merge_algorithm_min_columns_to_activate 1 --allow_vertical_merges_from_compact_to_wide_parts 1 --min_merge_bytes_to_use_direct_io 10737418240 --index_granularity_bytes 17322748 --merge_max_block_size 21673 --index_granularity 22025 --min_bytes_for_wide_part 1073741824 --marks_compress_block_size 78393 --primary_key_compress_block_size 70705 --replace_long_file_name_to_hash 0 --max_file_name_length 0 --min_bytes_for_full_part_storage 0 --compact_parts_max_bytes_to_buffer 171020629 --compact_parts_max_granules_to_buffer 256 --compact_parts_merge_max_bytes_to_prefetch_part 2793395 --cache_populated_by_fetch 0 --concurrent_part_removal_threshold 100 --old_parts_lifetime 480 2026-10-30 10:29:26 2026-10-30 10:29:26 Database: test_vhfypo2j 2026-10-30 10:29:26 All tests have finished. 2026-10-30 10:29:26 2026-10-30 10:29:26 Top patterns of log messages: 2026-10-30 10:29:26 2026-10-30 10:29:26 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string 2026-10-30 10:29:26 2026-10-30 10:29:26 1. 265387 0.075 11.80 MiB 0.033 1 1151 ['Trace'] 1 is disk {} eligible for search: {} 2026-10-30 10:29:26 2. 143897 0.041 38.22 MiB 0.106 1 261 ['Debug'] 0 (from {}{}{}){}{} {} (stage: {}) 2026-10-30 10:29:26 3. 143819 0.041 21.53 MiB 0.06 43855 258 ['Trace'] 1 {} Creating query context from {} context, user_id: {}, parent context user: {} 2026-10-30 10:29:26 4. 129670 0.037 5.67 MiB 0.016 1 1 ['Trace'] 1 Processing requests batch, size: {}, bytes: {} 2026-10-30 10:29:26 5. 121944 0.034 2.91 MiB 0.008 1 730 ['Trace'] 0.001 Query to stage {}{} 2026-10-30 10:29:26 6. 120426 0.034 5.65 MiB 0.016 1 729 ['Trace'] 0.001 Query from stage {} to stage {}{} 2026-10-30 10:29:26 7. 119913 0.034 3.29 MiB 0.009 1 214 ['Debug'] 0 Processed in {} sec. 2026-10-30 10:29:26 8. 79137 0.022 6.26 MiB 0.017 1 246 ['Debug'] 0 Read {} rows, {} in {} sec., {} rows/sec., {}/sec. 2026-10-30 10:29:26 9. 77179 0.022 5.30 MiB 0.015 1 1851 ['Trace'] 0.547 Reserved {} on local disk {}, having unreserved {}. 2026-10-30 10:29:26 10. 72948 0.021 2.34 MiB 0.007 1 1718 ['Trace'] 0 Aggregation method: {} 2026-10-30 10:29:26 11. 71855 0.02 8.03 MiB 0.022 2887 1353 ['Trace'] 0.416 Renaming temporary part {} to {} with tid {}. 2026-10-30 10:29:26 12. 68297 0.019 4.62 MiB 0.013 2874 1851 ['Trace'] 0.506 Trying to reserve {} using storage policy from min volume index {} 2026-10-30 10:29:26 13. 68118 0.019 6.11 MiB 0.017 1 1712 ['Trace'] 0 Aggregated. {} to {} rows (from {}) in {} sec. ({:.3f} rows/sec., {}/sec.) 2026-10-30 10:29:26 14. 57506 0.016 617.74 KiB 0.002 1 1695 ['Trace'] 0 Aggregating 2026-10-30 10:29:26 15. 53148 0.015 4.19 MiB 0.012 1 1676 ['Trace'] 0 An entry for key={} found in cache: sum_of_sizes={}, median_size={} 2026-10-30 10:29:26 16. 51969 0.015 2.35 MiB 0.007 1 1347 ['Trace'] 0.139 filled checksums {} 2026-10-30 10:29:26 17. 45829 0.013 2.20 MiB 0.006 1 259 ['Debug'] 0.254 Peak memory usage{}: {}. 2026-10-30 10:29:26 18. 44529 0.013 2.01 MiB 0.006 44529 419 ['Debug'] 0.996 Authenticating user '{}' from {} 2026-10-30 10:29:26 19. 44501 0.013 4.88 MiB 0.014 44501 419 ['Debug'] 0.996 {} Authenticated with global context as user {} 2026-10-30 10:29:26 20. 44453 0.013 3.82 MiB 0.011 44453 417 ['Debug'] 0.996 {} Logout, user_id: {} 2026-10-30 10:29:26 21. 44092 0.012 3.15 MiB 0.009 44092 258 ['Debug'] 1 Creating session context with user_id: {} 2026-10-30 10:29:26 22. 43430 0.012 9.35 MiB 0.026 3 244 ['Trace'] 1 HTTP Request for {}. Method: {}, Address: {}, User-Agent: {}{}, Content Type: {}, Transfer Encoding: {}, X-Forwarded-For: {} 2026-10-30 10:29:26 23. 43421 0.012 22.37 MiB 0.062 2 244 ['Trace'] 1 Request URI: {} 2026-10-30 10:29:26 24. 42031 0.012 3.24 MiB 0.009 1656 277 ['Trace'] 0.001 Reading {} ranges in{}order from part {}, approx. {} rows starting from {} 2026-10-30 10:29:26 25. 41767 0.012 856.55 KiB 0.002 2 244 ['Debug'] 0.505 Done processing query 2026-10-30 10:29:26 26. 41671 0.012 3.65 MiB 0.01 454 522 ['Trace'] 0.999 Insert entry {} to queue with type {} 2026-10-30 10:29:26 27. 40692 0.011 3.11 MiB 0.009 748 1583 ['Trace'] 0.928 Part {} is not stored on zero-copy replicated disk, blobs can be removed 2026-10-30 10:29:26 28. 35834 0.01 2.98 MiB 0.008 916 512 ['Trace'] 1 Scheduling next merge selecting task after {}ms, current attempt status: {} 2026-10-30 10:29:26 29. 35633 0.01 4.84 MiB 0.013 667 512 ['Trace'] 1 Checked {} partitions, found {} partitions with parts that may be merged: [{}] (max_total_size_to_merge={}, merge_with_ttl_allowed={}) 2026-10-30 10:29:26 30. 33052 0.009 3.92 MiB 0.011 1 2 ['Trace'] 1 Creating part at path {} 2026-10-30 10:29:26 31. 32620 0.009 2.92 MiB 0.008 1 105 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part 2026-10-30 10:29:26 32. 29936 0.008 1.68 MiB 0.005 454 522 ['Debug'] 0.999 Pulling {} entries to queue: {} - {} 2026-10-30 10:29:26 33. 29936 0.008 760.09 KiB 0.002 454 522 ['Debug'] 0.999 Pulled {} entries to queue. 2026-10-30 10:29:26 34. 27766 0.008 826.59 KiB 0.002 1816 341 ['Debug'] 0.004 Key condition: {} 2026-10-30 10:29:26 35. 27048 0.008 2.69 MiB 0.007 275 33 ['Debug'] 1 Fetching part {} from {}:{} 2026-10-30 10:29:26 36. 26580 0.007 1012.24 KiB 0.003 365 35 ['Debug'] 0.79 Committing part {} to zookeeper 2026-10-30 10:29:26 37. 26226 0.007 589.06 KiB 0.002 1 1192 ['Trace'] 0 Merging aggregated data 2026-10-30 10:29:26 38. 25465 0.007 943.41 KiB 0.003 362 32 ['Debug'] 0.825 Part {} committed to zookeeper 2026-10-30 10:29:26 39. 23834 0.007 1.02 MiB 0.003 1811 341 ['Trace'] 0.005 Filtering marks by primary and secondary keys 2026-10-30 10:29:26 40. 23562 0.007 2.62 MiB 0.007 1804 341 ['Debug'] 0.005 Selected {}/{} parts by partition key, {} parts by primary key, {}/{} marks by primary key, {} marks to read from {} ranges 2026-10-30 10:29:26 41. 23548 0.007 768.30 KiB 0.002 2 219 ['Trace'] 1 TCP Request. Address: {} 2026-10-30 10:29:26 42. 23546 0.007 2.23 MiB 0.006 1 219 ['Debug'] 1 Connected {} version {}.{}.{}, revision: {}{}{}. 2026-10-30 10:29:26 43. 23473 0.007 618.92 KiB 0.002 1 208 ['Debug'] 1 Done processing connection. 2026-10-30 10:29:26 44. 22624 0.006 1.90 MiB 0.005 275 40 ['Trace'] 1 Trying to fetch with zero-copy replication, but disk is not provided, will try to select 2026-10-30 10:29:26 45. 22624 0.006 817.44 KiB 0.002 275 40 ['Trace'] 1 Checking disk {} with type {} 2026-10-30 10:29:26 46. 22409 0.006 1.13 MiB 0.003 1575 333 ['Trace'] 0.005 Spreading mark ranges among streams (default reading) 2026-10-30 10:29:26 47. 21476 0.006 755.03 KiB 0.002 1 111 ['Trace'] 1 Keeper request. Address: {} 2026-10-30 10:29:26 48. 21085 0.006 463.64 KiB 0.001 229 72 ['Trace'] 1 Sending part {} 2026-10-30 10:29:26 49. 21080 0.006 408.82 KiB 0.001 275 41 ['Debug'] 1 Downloading files {} 2026-10-30 10:29:26 50. 21077 0.006 1.75 MiB 0.005 275 41 ['Trace'] 1 Disk for fetch is not provided, getting disk from reservation {} with type '{}' 2026-10-30 10:29:26 51. 21073 0.006 936.71 KiB 0.003 272 41 ['Debug'] 1 Downloading part {} onto disk {}. 2026-10-30 10:29:26 52. 21067 0.006 1.10 MiB 0.003 271 41 ['Debug'] 1 Download of part {} onto disk {} finished. 2026-10-30 10:29:26 53. 21003 0.006 2.04 MiB 0.006 273 33 ['Debug'] 1 Fetched part {} from {}:{}{} 2026-10-30 10:29:26 54. 20952 0.006 1.32 MiB 0.004 74 501 ['Debug'] 1 There is no part {} in ZooKeeper, it was only in filesystem 2026-10-30 10:29:26 55. 18868 0.005 589.63 KiB 0.002 1 101 ['Debug'] 1 Receive four letter command {} 2026-10-30 10:29:26 56. 16028 0.005 641.75 KiB 0.002 193 604 ['Debug'] 0.627 Will use old analyzer to prepare mutation 2026-10-30 10:29:26 57. 14560 0.004 867.34 KiB 0.002 3584 236 ['Debug'] 0.009 There are {} detached tables. Start searching non used tables. 2026-10-30 10:29:26 58. 14560 0.004 611.41 KiB 0.002 3584 236 ['Debug'] 0.009 Found {} non used tables in detached tables. 2026-10-30 10:29:26 59. 14471 0.004 1.09 MiB 0.003 1 216 ['Trace'] 0 Query span trace_id for opentelemetry log: {} 2026-10-30 10:29:26 60. 14373 0.004 1.50 MiB 0.004 1 76 ['Debug'] 0 Reading {} marks from part {}, total {} rows starting from the beginning of the part, column {} 2026-10-30 10:29:26 61. 13868 0.004 1.25 MiB 0.003 13 13 ['Debug'] 0 Waiting for currently running merges ({} parts are merging right now) to perform OPTIMIZE FINAL 2026-10-30 10:29:26 62. 11913 0.003 1.35 MiB 0.004 5133 16 ['Trace'] 1 Executing log entry to merge parts {} to {} 2026-10-30 10:29:26 63. 10744 0.003 853.43 KiB 0.002 1 1145 ['Trace'] 0 Statistics updated for key={}: new sum_of_sizes={}, median_size={} 2026-10-30 10:29:26 64. 8933 0.003 545.99 KiB 0.001 35 32 ['Debug'] 1 Part {} is rendered obsolete by fetching part {} 2026-10-30 10:29:26 65. 8888 0.003 435.83 KiB 0.001 734 617 ['Debug'] 0.91 Selected {} parts from {} to {} 2026-10-30 10:29:26 66. 8681 0.002 1.75 MiB 0.005 2262 16 ['Debug'] 1 Don't have all parts (at least {} is missing) for merge {}; will try to fetch it instead. Either pool for fetches is starving, see background_fetches_pool_size, or none of active replicas has it 2026-10-30 10:29:26 67. 8574 0.002 251.19 KiB 0.001 912 524 ['Debug'] 0.994 Updating strategy picker state 2026-10-30 10:29:26 68. 8572 0.002 285.86 KiB 0.001 419 146 ['Debug'] 0.001 MinMax index condition: {} 2026-10-30 10:29:26 69. 8350 0.002 313.97 KiB 0.001 383 189 ['Debug'] 0.01 Reading approx. {} rows with {} streams 2026-10-30 10:29:26 70. 8347 0.002 293.45 KiB 0.001 1 1014 ['Trace'] 0.008 Converting aggregated data to blocks 2026-10-30 10:29:26 71. 8314 0.002 871.33 KiB 0.002 1 1013 ['Debug'] 0.004 Converted aggregated data to blocks. {} rows, {} in {} sec. ({:.3f} rows/sec., {}/sec.) 2026-10-30 10:29:26 72. 8154 0.002 1.18 MiB 0.003 1 172 ['Trace'] 0.019 PREWHERE condition was split into {} steps: {} 2026-10-30 10:29:26 73. 7782 0.002 1.51 MiB 0.004 1 1151 ['Information'] 1 Removing metadata {} of dropped table {} 2026-10-30 10:29:26 74. 7780 0.002 577.42 KiB 0.002 1 167 ['Debug'] 0 Waiting for table {} to be finally dropped 2026-10-30 10:29:26 75. 7780 0.002 896.52 KiB 0.002 1 167 ['Debug'] 0 Done waiting for the table {} to be dropped. The outcome: {} 2026-10-30 10:29:26 76. 7411 0.002 209.88 KiB 0.001 1 1154 ['Debug'] 1 Stop worker in {} 2026-10-30 10:29:26 77. 7411 0.002 545.18 KiB 0.001 1 1073 ['Debug'] 1 Execute load job '{}' in {} 2026-10-30 10:29:26 78. 7411 0.002 289.50 KiB 0.001 1 1219 ['Debug'] 0.5 Spawn loader worker #{} in {} 2026-10-30 10:29:26 79. 7411 0.002 516.23 KiB 0.001 1 1073 ['Debug'] 1 Finish load job '{}' with status {} 2026-10-30 10:29:26 80. 7411 0.002 566.89 KiB 0.002 1 147 ['Debug'] 0.001 Schedule load job '{}' into {} 2026-10-30 10:29:26 81. 7410 0.002 689.84 KiB 0.002 1 147 ['Debug'] 0 Prioritize load job '{}': {} -> {} 2026-10-30 10:29:26 82. 7385 0.002 64.91 KiB 0 2 147 ['Trace'] 0.001 No tables 2026-10-30 10:29:26 83. 7376 0.002 244.91 KiB 0.001 1 1213 ['Debug'] 0.5 Change current priority: {} -> {} 2026-10-30 10:29:26 84. 7227 0.002 519.27 KiB 0.001 429 905 ['Debug'] 0 Wrote block with ID '{}', {} rows{} 2026-10-30 10:29:26 85. 6900 0.002 235.68 KiB 0.001 1 109 ['Debug'] 0 Selected MergeAlgorithm: {} 2026-10-30 10:29:26 86. 6900 0.002 545.99 KiB 0.001 1 109 ['Debug'] 0 Merging {} parts: from {} to {} into {} with storage {} 2026-10-30 10:29:26 87. 6890 0.002 3.36 MiB 0.009 2 27 ['Error'] 0 Number of arguments for function {} doesn't match: passed {}, should be {} 2026-10-30 10:29:26 88. 6880 0.002 889.77 KiB 0.002 1 109 ['Debug'] 0 Merge sorted {} rows, containing {} columns ({} merged, {} gathered) in {} sec., {} rows/sec., {}/sec. 2026-10-30 10:29:26 89. 6868 0.002 409.34 KiB 0.001 578 109 ['Trace'] 0 Merged {} parts: [{}, {}] -> {} 2026-10-30 10:29:26 90. 6787 0.002 470.15 KiB 0.001 268 967 ['Trace'] 0.009 Running binary search on index range for part {} ({} marks) 2026-10-30 10:29:26 91. 6787 0.002 201.03 KiB 0.001 268 967 ['Trace'] 0.009 Found (RIGHT) boundary mark: {} 2026-10-30 10:29:26 92. 6787 0.002 193.97 KiB 0.001 268 967 ['Trace'] 0.009 Found (LEFT) boundary mark: {} 2026-10-30 10:29:26 93. 6787 0.002 207.51 KiB 0.001 268 967 ['Trace'] 0.009 Found {} range {}in {} steps 2026-10-30 10:29:26 94. 6398 0.002 462.38 KiB 0.001 1 512 ['Information'] 1 Have {} tables in drop queue ({} of them are in use), will try drop {} tables 2026-10-30 10:29:26 95. 6208 0.002 771.94 KiB 0.002 10 511 ['Debug'] 1 Not executing log entry {} of type {} for part {} because merges and mutations are cancelled now. 2026-10-30 10:29:26 96. 6161 0.002 852.61 KiB 0.002 2356 1488 ['Debug'] 0.979 Removing {} parts from filesystem (serially): Parts: [{}] 2026-10-30 10:29:26 97. 6027 0.002 219.61 KiB 0.001 18 18 ['Trace'] 1 Flushed system log up to offset {} 2026-10-30 10:29:26 98. 6027 0.002 352.30 KiB 0.001 18 18 ['Trace'] 1 Flushing system log, {} entries to flush up to offset {} 2026-10-30 10:29:26 99. 5783 0.002 1.09 MiB 0.003 1 273 ['Trace'] 0.001 {}Keys: {}, datatype: {}, kind: {}, strictness: {}, right header: {} 2026-10-30 10:29:26 100. 5419 0.002 281.34 KiB 0.001 1 16 ['Trace'] 0 Mutating part {} to mutation version {} 2026-10-30 10:29:26 2026-10-30 10:29:26 count count_% size size_% uniq_loggers uniq_threads levels background_% message_format_string 2026-10-30 10:29:26 2026-10-30 10:29:26 2026-10-30 10:29:26 2026-10-30 10:29:26 Top messages without format string (fmt::runtime): 2026-10-30 10:29:26 2026-10-30 10:29:26 count pattern runtime_message line 2026-10-30 10:29:26 2026-10-30 10:29:26 1. 1708 IfthesignaturecheckfailedThiscou If the signature check failed. This could be because of a time skew. Attempting to adjust the signer. ('/AWSLogger.cpp',71) 2026-10-30 10:29:26 2. 48 CodeDBExceptionSyntaxerrorfailed Code: 62. DB::Exception: Syntax error: failed at position 1 ('SEECTwrong'): SEECTwrong. Expected one of: Query, Query with output, EXPLAIN, EXPLAIN, SELECT query, possibly with UNION, list of union elements, SELECT query, subquery, possibly with UNION, SEL ('/executeQuery.cpp',221) 2026-10-30 10:29:26 3. 16 CodeDBExceptionEmptyqueryInscope Code: 62. DB::Exception: Empty query: In scope SELECT formatQuery(''). (SYNTAX_ERROR) (version 24.8.14.10550.altinitytest (altinity build)) (from [::1]:33462) (comment: 02882_formatQuery.sql) (in query: SELECT formatQuery('');), Stack trace (when copying t ('/executeQuery.cpp',221) 2026-10-30 10:29:26 4. 8 CodeDBExceptionReceivedfromDBExc Code: 507. DB::Exception: Received from 127.0.0.2:9000. DB::Exception: Sharding key modulo(sub_key, 2) is not used. Stack trace: 2026-10-30 10:29:26 2026-10-30 10:29:26 0. std::exception::capture() @ 0x0000000018f4398b 2026-10-30 10:29:26 1. ./build_docker/./base/poco/Foundation/src/Exception.cpp:28: Poco::Excepti ('/executeQuery.cpp',221) 2026-10-30 10:29:26 5. 8 CodeCoordinationExceptionFaultin Code: 999. Coordination::Exception: Fault injection before operation. (KEEPER_EXCEPTION) (version 24.8.14.10550.altinitytest (altinity build)) (from [::1]:37220) (comment: 02456_keeper_retries_during_insert.sql) (in query: INSERT INTO keeper_retries_r1 SET ('/executeQuery.cpp',221) 2026-10-30 10:29:26 6. 8 CodeDBExceptionReceivedfromlocal Code: 60. DB::Exception: Received from localhost:9000. DB::Exception: Table shard_1.data_01850 does not exist. Maybe you meant shard_1.data_02346?. Stack trace: 2026-10-30 10:29:26 2026-10-30 10:29:26 0. std::exception::capture() @ 0x0000000018f4398b 2026-10-30 10:29:26 1. ./build_docker/./base/poco/Foundation/src ('/executeQuery.cpp',221) 2026-10-30 10:29:26 7. 6 CodeDBExceptionboostwrapexceptbo Code: 1001. DB::Exception: boost::wrapexcept: Should start with 'LINESTRING'' in (). (STD_EXCEPTION) ('/TCPHandler.cpp',765) 2026-10-30 10:29:26 8. 6 stdexceptionCodetypeboostwrapexc std::exception. Code: 1001, type: boost::wrapexcept, e.what() = Should start with 'LINESTRING'' in () (version 24.8.14.10550.altinitytest (altinity build)) (from [::1]:56752) (comment: 00534_functions_bad_arguments7.sh) ('/executeQuery.cpp',221) 2026-10-30 10:29:26 9. 5 PocoExceptionCodeecodeBadURIsynt Poco::Exception. Code: 1000, e.code() = 0, Bad URI syntax: URI contains invalid characters (version 24.8.14.10550.altinitytest (altinity build)) (from [::1]:37202) (comment: 00746_sql_fuzzy.sh) (in query: SELECT * FROM deltaLake('\0');), Stack trace (when ('/executeQuery.cpp',221) 2026-10-30 10:29:26 10. 4 CodeDBExceptionExpectedargumento Code: 395. DB::Exception: Expected argument of data type real: while executing 'FUNCTION throwIf(_CAST(true_Bool, 'Bool'_String) :: 1, 'Expected argument of data type real'_String :: 2) -> throwIf(_CAST(true_Bool, 'Bool'_String), 'Expected argument of data ('/executeQuery.cpp',221) 2026-10-30 10:29:26 11. 4 CodeDBExceptionTherequestsignatu Code: 499. DB::Exception: The request signature we calculated does not match the signature you provided. Check your key and signing method. (S3_ERROR) (version 24.8.14.10550.altinitytest (altinity build)) (from [::1]:51316) (comment: 02843_backup_use_same_ ('/executeQuery.cpp',221) 2026-10-30 10:29:26 12. 4 CodeDBExceptionBadURIsyntaxURIco Code: 1000. DB::Exception: Bad URI syntax: URI contains invalid characters. (POCO_EXCEPTION), Stack trace (when copying this message, always include the lines below): 2026-10-30 10:29:26 2026-10-30 10:29:26 0. std::exception::capture() @ 0x0000000018f4398b 2026-10-30 10:29:26 1. ./build_docker/./base/poco/Foundati ('/TCPHandler.cpp',765) 2026-10-30 10:29:26 13. 2 CodeDBExceptionSyntaxerrorcolumn Code: 62. DB::Exception: Syntax error (columns declaration list): failed at position 1 (''): . Unrecognized token: ''. (SYNTAX_ERROR) (version 24.8.14.10550.altinitytest (altinity build)) (from [::1]:54534) (comment: 00746_sql_fuzzy.sh) (in query: SELEC ('/executeQuery.cpp',221) 2026-10-30 10:29:26 14. 2 createsnapshotidxlogtermdoneusel create snapshot idx 100000 log_term 1 done: 123 us elapsed ('/LoggerWrapper.h',43) 2026-10-30 10:29:26 15. 2 createsnapshotidxlogterm create snapshot idx 100000 log_term 1 ('/LoggerWrapper.h',43) 2026-10-30 10:29:26 16. 2 CodeDBExceptionFailedtogetobject Code: 499. DB::Exception: Failed to get object info: No response body.. HTTP response code: 404: while reading test: The table structure cannot be extracted from a CSV format file. You can specify the structure manually. (S3_ERROR) (version 24.8.14.10550.a ('/executeQuery.cpp',221) 2026-10-30 10:29:26 17. 2 creatingasnapshotforindex creating a snapshot for index 100000 ('/LoggerWrapper.h',43) 2026-10-30 10:29:26 18. 2 CodeDBExceptionThereisnosubtypef Code: 386. DB::Exception: There is no subtype for types String, UInt8 because some of them are String/FixedString and some of them are not: In scope SELECT ['1', '2'] AS arr1, [1, 2] AS arr2, round(arrayJaccardIndex(arr1, arr2), 2). (NO_COMMON_TYPE) (versi ('/executeQuery.cpp',221) 2026-10-30 10:29:26 19. 2 snapshotidxlogtermcreatedcompact snapshot idx 100000 log_term 1 created, compact the log store if needed ('/LoggerWrapper.h',43) 2026-10-30 10:29:26 20. 2 CodeDBExceptionEmptyquerySYNTAXE Code: 62. DB::Exception: Empty query. (SYNTAX_ERROR) (version 24.8.14.10550.altinitytest (altinity build)) (from [::ffff:127.0.0.1]:55302) (in query: ), Stack trace (when copying this message, always include the lines below): 2026-10-30 10:29:26 2026-10-30 10:29:26 0. std::exception::capture() ('/executeQuery.cpp',221) 2026-10-30 10:29:26 21. 2 CodeDBExceptionOutofmemoryalloca Code: 173. DB::Exception: Out of memory: allocation of size 80003648 failed: (in file/uri /var/lib/clickhouse/user_files/03147_parquet_memory_tracking.parquet): While executing ParquetBlockInputFormat: While executing File. (CANNOT_ALLOCATE_MEMORY) (versio ('/executeQuery.cpp',221) 2026-10-30 10:29:26 22. 1 CodeDBExceptionavroExceptionCann Code: 1001. DB::Exception: avro::Exception: Cannot read compressed data, expected at least 4 bytes, got 0. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below): 2026-10-30 10:29:26 2026-10-30 10:29:26 0. std::exception::capture() @ 0x0000000018f4398b 2026-10-30 10:29:26 1. ./con ('/TCPHandler.cpp',765) 2026-10-30 10:29:26 23. 1 Forkedachildprocesstowatch Forked a child process to watch ('',0) 2026-10-30 10:29:26 24. 1 FailedtomakebackupShttplocalhost Failed to make backup S3('http://localhost:11111/test/backups/test_4t0ynkhh/use_same_s3_credentials_for_base_backup_base_inc_3_bad', 'test', '[HIDDEN]'): Code: 499. DB::Exception: The request signature we calculated does not match the signature you provide ('/Exception.cpp',273) 2026-10-30 10:29:26 25. 1 Electiontimeoutinitiateleaderele Election timeout, initiate leader election ('/LoggerWrapper.h',43) 2026-10-30 10:29:26 26. 1 CodeDBExceptionstdruntimeerrorra Code: 1001. DB::Exception: std::runtime_error: ran out of bytes. (STD_EXCEPTION), Stack trace (when copying this message, always include the lines below): 2026-10-30 10:29:26 2026-10-30 10:29:26 0. std::exception::capture() @ 0x0000000018f4398b 2026-10-30 10:29:26 1. ./contrib/llvm-project/libcxx/src/support/runti ('/TCPHandler.cpp',765) 2026-10-30 10:29:26 27. 1 bgappendentriesthreadinitiated bg append_entries thread initiated ('/LoggerWrapper.h',43) 2026-10-30 10:29:26 28. 1 statemachinecommitindexprecommit state machine commit index 0, precommit index 0, last log index 0 ('/LoggerWrapper.h',43) 2026-10-30 10:29:26 29. 1 newconfigurationlogidxprevlogidx new configuration: log idx 1, prev log idx 0 2026-10-30 10:29:26 peer 1, DC ID 0, localhost:9234, voting member, 1 2026-10-30 10:29:26 my id: 1, leader: 1, term: 1 ('/LoggerWrapper.h',43) 2026-10-30 10:29:27 30. 1 StartingClickHousealtinitytestre Starting ClickHouse 24.8.14.10550.altinitytest (revision: 4294967295, git hash: 77bb5f60cb900b3241b66f4d944f121e7fd44637, build id: ACC682D82FA66BFC06DB278BEEEA60477C5CE971), PID 595 ('',0) 2026-10-30 10:29:27 2026-10-30 10:29:27 2026-10-30 10:29:27 2026-10-30 10:29:27 Top messages not matching their format strings: 2026-10-30 10:29:27 2026-10-30 10:29:27 message_format_string count() any_message 2026-10-30 10:29:27 2026-10-30 10:29:27 1. 1753 creating a snapshot for index 200000 2026-10-30 10:29:27 message_format_string count() any_message 2026-10-30 10:29:27 2026-10-30 10:29:27 2. Illegal UTF-8 sequence, while processing '{}' 12 Code: 36. DB::Exception: Illegal UTF-8 sequence, while processing '�': while executing 'FUNCTION stringJaccardIndexUTF8(materialize('hello'_String) :: 3, materialize('�'_String) :: 1) -> stringJaccardIndexUTF8(materialize('hello'_String), materialize('�'_String)) Float64 : 2'. (BAD_ARGUMENTS) (version 24.8.14.10550.altinitytest (altinity build)) (from [::1]:56254) (comment: 02884_string_distance_function.sql) (in query: SELECT stringJaccardIndexUTF8(materialize('hello'), materialize('\xC2\x01'));), Stack trace (when copying this message, always include the lines below): 2026-10-30 10:29:27 2026-10-30 10:29:27 0. std::exception::capture() @ 0x0000000018f4398b 2026-10-30 10:29:27 1. ./build_docker/./base/poco/Foundation/src/Exception.cpp:28: Poco::Exception::Exception(String const&, int) @ 0x0000000038036a45 2026-10-30 10:29:27 2. ./build_docker/./src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x0000000025881b6b 2026-10-30 10:29:27 3. DB::Exception::Exception(PreformattedMessage&&, int) @ 0x0000000018f1b136 2026-10-30 10:29:27 4. DB::Exception::Exception(int, FormatStringHelperImpl::type>, StringRef&&) @ 0x000000001a5e5d6f 2026-10-30 10:29:27 5. DB::parseUTF8String(char const*, unsigned long, std::function, std::function) @ 0x000000001a5e514c 2026-10-30 10:29:27 6. DB::ByteJaccardIndexImpl::process(char const*, unsigned long, char const*, unsigned long) @ 0x000000001a5fd60b 2026-10-30 10:29:27 7. DB::FunctionStringDistanceImpl>::vectorVector(DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul> const&, DB::PODArray, 63ul, 64ul>&, unsigned long) @ 0x000000001a5fcce1 2026-10-30 10:29:27 8. DB::FunctionsStringSimilarity>, DB::NameJaccardIndexUTF8>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x000000001a5fbb1d 2026-10-30 10:29:27 9. DB::FunctionToExecutableFunctionAdaptor::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000018f49279 2026-10-30 10:29:27 10. DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000001a6c7cef 2026-10-30 10:29:27 11. DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000001a6c97e9 2026-10-30 10:29:27 12. DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000001a6cb0c8 2026-10-30 10:29:27 13. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::executeAction(DB::ExpressionActions::Action const&, DB::(anonymous namespace)::ExecutionContext&, bool, bool) @ 0x000000003122e159 2026-10-30 10:29:27 14. ./build_docker/./src/Interpreters/ExpressionActions.cpp:0: DB::ExpressionActions::execute(DB::Block&, unsigned long&, bool, bool) const @ 0x000000003122bc07 2026-10-30 10:29:27 15. ./build_docker/./src/Processors/Transforms/ExpressionTransform.cpp:0: DB::ExpressionTransform::transform(DB::Chunk&) @ 0x0000000034e0659e 2026-10-30 10:29:27 16. ./contrib/llvm-project/libcxx/include/__utility/swap.h:35: DB::ISimpleTransform::transform(DB::Chunk&, DB::Chunk&) @ 0x0000000025da9bf6 2026-10-30 10:29:27 17. ./build_docker/./src/Processors/ISimpleTransform.cpp:99: DB::ISimpleTransform::work() @ 0x00000000347c906a 2026-10-30 10:29:27 18. ./build_docker/./src/Processors/Executors/ExecutionThreadContext.cpp:50: DB::ExecutionThreadContext::executeTask() @ 0x00000000347fc720 2026-10-30 10:29:27 19. ./build_docker/./src/Processors/Executors/PipelineExecutor.cpp:273: DB::PipelineExecutor::executeStepImpl(unsigned long, std::atomic*) @ 0x00000000347e7e9b 2026-10-30 10:29:27 20. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:701: DB::PipelineExecutor::executeImpl(unsigned long, bool) @ 0x00000000347e7016 2026-10-30 10:29:27 21. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:274: DB::PipelineExecutor::execute(unsigned long, bool) @ 0x00000000347e6c2a 2026-10-30 10:29:27 22. ./build_docker/./src/Processors/Executors/PullingAsyncPipelineExecutor.cpp:0: void std::__function::__policy_invoker::__call_impl::ThreadFromGlobalPoolImpl(DB::PullingAsyncPipelineExecutor::pull(DB::Chunk&, unsigned long)::$_0&&)::'lambda'(), void ()>>(std::__function::__policy_storage const*) @ 0x0000000034801bca 2026-10-30 10:29:27 23. ./contrib/llvm-project/libcxx/include/__functional/function.h:0: ? @ 0x00000000259b74cf 2026-10-30 10:29:27 24. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: void* std::__thread_proxy[abi:v15007]>, void (ThreadPoolImpl::ThreadFromThreadPool::*)(), ThreadPoolImpl::ThreadFromThreadPool*>>(void*) @ 0x00000000259bee8a 2026-10-30 10:29:27 25. ? @ 0x00007f058c47aac3 2026-10-30 10:29:27 26. ? @ 0x00007f058c50c8d0 2026-10-30 10:29:27 2026-10-30 10:29:27 message_format_string count() any_message 2026-10-30 10:29:27 2026-10-30 10:29:27 3. Close WriteBufferFromAzureBlobStorage. {}. 4 Close WriteBufferFromAzureBlobStorage. xzxpsqvkipnjdaqvqzfifrcvgqphleny. (LogSeriesLimiter: on interval from 2026-10-30 10:13:30 to 2026-10-30 10:14:10 accepted series 1 / 10 for the logger WriteBufferFromAzureBlobStorage) 2026-10-30 10:29:27 message_format_string count() any_message 2026-10-30 10:29:27 2026-10-30 10:29:27 4. Substitution '\{}' in replacement argument is invalid, regexp has only {} capturing groups 4 Code: 36. DB::Exception: Substitution '\1' in replacement argument is invalid, regexp has only 0 capturing groups. (BAD_ARGUMENTS) (version 24.8.14.10550.altinitytest (altinity build)) (from [::1]:50464) (comment: 02864_replace_regexp_string_fallback.sql) (in query: -- negative tests 2026-10-30 10:29:27 -- Even if the fallback is used, invalid substitutions must throw an exception. 2026-10-30 10:29:27 SELECT 'Hello' AS haystack, 'l' AS needle, '\\1' AS replacement, replaceRegexpOne(materialize(haystack), needle, replacement);), Stack trace (when copying this message, always include the lines below): 2026-10-30 10:29:27 2026-10-30 10:29:27 0. std::exception::capture() @ 0x0000000018f4398b 2026-10-30 10:29:27 1. ./build_docker/./base/poco/Foundation/src/Exception.cpp:28: Poco::Exception::Exception(String const&, int) @ 0x0000000038036a45 2026-10-30 10:29:27 2. ./build_docker/./src/Common/Exception.cpp:111: DB::Exception::Exception(DB::Exception::MessageMasked&&, int, bool) @ 0x0000000025881b6b 2026-10-30 10:29:27 3. DB::Exception::Exception(PreformattedMessage&&, int) @ 0x0000000018f1b136 2026-10-30 10:29:27 4. DB::Exception::Exception(int, FormatStringHelperImpl::type, std::type_identity::type>, int&, int&&) @ 0x0000000022b3e66f 2026-10-30 10:29:27 5. DB::ReplaceRegexpImpl::checkSubstitutions(std::basic_string_view>, int) @ 0x0000000022b45cd3 2026-10-30 10:29:27 6. DB::FunctionStringReplace, DB::(anonymous namespace)::NameReplaceRegexpOne>::executeImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000022b419b7 2026-10-30 10:29:27 7. DB::IFunction::executeImplDryRun(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000018f1a226 2026-10-30 10:29:27 8. DB::FunctionToExecutableFunctionAdaptor::executeDryRunImpl(std::vector> const&, std::shared_ptr const&, unsigned long) const @ 0x0000000018f493d9 2026-10-30 10:29:27 9. DB::IExecutableFunction::executeWithoutLowCardinalityColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000001a6c7c83 2026-10-30 10:29:27 10. DB::IExecutableFunction::executeWithoutSparseColumns(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000001a6c97e9 2026-10-30 10:29:27 11. DB::IExecutableFunction::execute(std::vector> const&, std::shared_ptr const&, unsigned long, bool) const @ 0x000000001a6cb0c8 2026-10-30 10:29:27 12. ./contrib/boost/boost/smart_ptr/intrusive_ptr.hpp:117: DB::ActionsDAG::evaluatePartialResult(std::unordered_map, std::equal_to, std::allocator>>&, std::vector> const&, unsigned long, bool) @ 0x0000000030e81580 2026-10-30 10:29:27 13. ./contrib/llvm-project/libcxx/include/vector:961: DB::ActionsDAG::updateHeader(DB::Block const&) const @ 0x0000000030e7f83b 2026-10-30 10:29:27 14. ./build_docker/./src/Processors/Transforms/ExpressionTransform.cpp:10: DB::ExpressionTransform::transformHeader(DB::Block const&, DB::ActionsDAG const&) @ 0x0000000034e0625f 2026-10-30 10:29:27 15. ./build_docker/./src/Processors/QueryPlan/ExpressionStep.cpp:32: DB::ExpressionStep::ExpressionStep(DB::DataStream const&, DB::ActionsDAG) @ 0x0000000035146faf 2026-10-30 10:29:27 16. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:714: std::__unique_if::__unique_single std::make_unique[abi:v15007](DB::DataStream const&, DB::ActionsDAG&&) @ 0x000000002f9f1a87 2026-10-30 10:29:27 17. ./build_docker/./src/Planner/Planner.cpp:345: DB::(anonymous namespace)::addExpressionStep(DB::QueryPlan&, std::shared_ptr&, String const&, std::unordered_set, std::hash>, std::equal_to>, std::allocator>>&) @ 0x0000000031a737ef 2026-10-30 10:29:27 18. ./contrib/llvm-project/libcxx/include/string:1499: DB::Planner::buildPlanForQueryNode() @ 0x0000000031a69ebc 2026-10-30 10:29:27 19. ./contrib/llvm-project/libcxx/include/__memory/shared_ptr.h:815: DB::Planner::buildQueryPlanIfNeeded() @ 0x0000000031a5f69b 2026-10-30 10:29:27 20. ./build_docker/./src/Interpreters/InterpreterSelectQueryAnalyzer.cpp:235: DB::InterpreterSelectQueryAnalyzer::getQueryPlan() @ 0x0000000031a5bb6f 2026-10-30 10:29:27 21. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:274: DB::executeQueryImpl(char const*, char const*, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum, DB::ReadBuffer*) @ 0x0000000031fba6f2 2026-10-30 10:29:27 22. ./build_docker/./src/Interpreters/executeQuery.cpp:1397: DB::executeQuery(String const&, std::shared_ptr, DB::QueryFlags, DB::QueryProcessingStage::Enum) @ 0x0000000031fb4693 2026-10-30 10:29:27 23. ./build_docker/./src/Server/TCPHandler.cpp:569: DB::TCPHandler::runImpl() @ 0x0000000034687d68 2026-10-30 10:29:27 24. ./build_docker/./src/Server/TCPHandler.cpp:2527: DB::TCPHandler::run() @ 0x00000000346bf176 2026-10-30 10:29:27 25. ./build_docker/./base/poco/Net/src/TCPServerConnection.cpp:57: Poco::Net::TCPServerConnection::start() @ 0x0000000038187578 2026-10-30 10:29:27 26. ./contrib/llvm-project/libcxx/include/__memory/unique_ptr.h:302: Poco::Net::TCPServerDispatcher::run() @ 0x00000000381886b2 2026-10-30 10:29:27 27. ./build_docker/./base/poco/Foundation/src/ThreadPool.cpp:219: Poco::PooledThread::run() @ 0x00000000380dbe01 2026-10-30 10:29:27 28. ./base/poco/Foundation/include/Poco/AutoPtr.h:205: Poco::ThreadImpl::runnableEntry(void*) @ 0x00000000380d6dcf 2026-10-30 10:29:27 29. ? @ 0x00007f058c47aac3 2026-10-30 10:29:27 30. ? @ 0x00007f058c50c8d0 2026-10-30 10:29:27 2026-10-30 10:29:27 message_format_string count() any_message 2026-10-30 10:29:27 2026-10-30 10:29:28 5. (from {}{}{}){}{} {} (stage: {}) 3 (from [::1]:41464) (comment: 01674_unicode_asan.sql) SELECT positionCaseInsensitiveUTF8('иголка.ру', 'иголка.р�\0') AS res; (stage: Complete) 2026-10-30 10:29:28 2026-10-30 10:29:28 2026-10-30 10:29:28 2026-10-30 10:29:28 Top short messages: 2026-10-30 10:29:28 2026-10-30 10:29:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-10-30 10:29:28 2026-10-30 10:29:28 1. 119 {} Server was built with undefined behavior sanitizer. It will work slowly. 46 2026-10-30 10:29:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-10-30 10:29:28 2026-10-30 10:29:28 2. 19 Creating {}: {} Creating table test_mgf0xbij.test: CREATE TABLE IF NOT EXISTS test_mgf0xbij.test UUID '800bde81-0f49-43bc-b087-2a8d14328 124 2026-10-30 10:29:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-10-30 10:29:28 2026-10-30 10:29:28 3. 12 Froze {} parts Froze 1 parts -13 2026-10-30 10:29:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-10-30 10:29:28 2026-10-30 10:29:28 4. 6 Bad SSH public key provided Code: 706. DB::Exception: Bad SSH public key provided. (LIBSSH_ERROR) (version 24.8.14.10550.altinitytest (altinity buil 29 2026-10-30 10:29:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-10-30 10:29:28 2026-10-30 10:29:28 5. 4 Unknown data type family: {} Code: 50. DB::Exception: Unknown data type family: ab. (UNKNOWN_TYPE) (version 24.8.14.10550.altinitytest (altinity buil 29 2026-10-30 10:29:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-10-30 10:29:28 2026-10-30 10:29:28 6. 2 Unknown setting '{}' Code: 115. DB::Exception: Unknown setting 'xxx_yyy'. (UNKNOWN_SETTING) (version 24.8.14.10550.altinitytest (altinity bui 27 2026-10-30 10:29:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-10-30 10:29:28 2026-10-30 10:29:28 7. 2 Substitution {} is not set Code: 456. DB::Exception: Substitution `s` is not set. (UNKNOWN_QUERY_PARAMETER) (version 24.8.14.10550.altinitytest (al 29 2026-10-30 10:29:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-10-30 10:29:28 2026-10-30 10:29:28 8. 2 Unknown table engine {} Code: 56. DB::Exception: Unknown table engine s3. (UNKNOWN_STORAGE) (version 24.8.14.10550.altinitytest (altinity build) 24 2026-10-30 10:29:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-10-30 10:29:28 2026-10-30 10:29:28 9. 2 Invalid cache key hex: {} Code: 36. DB::Exception: Invalid cache key hex: kek. (BAD_ARGUMENTS) (version 24.8.14.10550.altinitytest (altinity build 27 2026-10-30 10:29:28 c message_format_string substr(any(toValidUTF8(message)), 1, 120) min_length_without_exception_boilerplate 2026-10-30 10:29:28 2026-10-30 10:29:28 10. 2 Table {} is not empty Code: 705. DB::Exception: Table tab2 is not empty. (TABLE_NOT_EMPTY) (version 24.8.14.10550.altinitytest (altinity build 25 2026-10-30 10:29:28 2026-10-30 10:29:28 2026-10-30 10:29:28 2026-10-30 10:29:28 Top messages by level: 2026-10-30 10:29:28 2026-10-30 10:29:28 (0.0019407893068987877,'Number of arguments for function {} doesn\'t match: passed {}, should be {}') Error 2026-10-30 10:29:28 (0.00044815613748562717,'Not enabled four letter command {}') Warning 2026-10-30 10:29:28 (0.002192049693220082,'Removing metadata {} of dropped table {}') Information 2026-10-30 10:29:28 (0.040533201581250344,'(from {}{}{}){}{} {} (stage: {})') Debug 2026-10-30 10:29:28 (0.07475475352539167,'is disk {} eligible for search: {}') Trace 2026-10-30 10:29:28 2026-10-30 10:29:28 Files in current directory + set -e + echo 'Files in current directory' + ls -la ./ total 129436 drwxr-xr-x 1 root root 4096 Oct 30 10:20 . drwxr-xr-x 1 root root 4096 Oct 30 10:20 .. -rw-rw-r-- 1 1000 1000 119 Oct 30 09:45 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2380 Jul 22 16:40 attach_gdb.lib -rw-r--r-- 1 root root 53 Oct 30 09:49 AzuriteConfig -rw-r--r-- 1 root root 1834 Oct 30 10:14 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 4241 Oct 30 10:14 __azurite_db_blob__.json -rw-r--r-- 1 root root 2090133 Oct 30 10:29 azurite_log lrwxrwxrwx 1 root root 7 Apr 9 2026 bin -> usr/bin drwxr-xr-x 2 root root 4096 Oct 30 10:29 __blobstorage__ drwxr-xr-x 2 root root 4096 Apr 18 2022 boot -rw-rw-r-- 1 1000 1000 2149 Oct 30 09:45 broken_tests.json drwxr-x--- 4 root root 4096 Oct 30 10:15 data drwxr-xr-x 14 root root 3840 Oct 30 09:48 dev -rwxr-xr-x 1 root root 0 Oct 30 09:48 .dockerenv drwxr-xr-x 1 root root 4096 Oct 30 09:49 etc drwxr-x--- 2 root root 4096 Oct 30 10:15 flags drwxr-x--- 2 root root 4096 Oct 30 10:15 format_schemas drwxr-xr-x 1 1000 1000 4096 Oct 30 09:49 hadoop-3.3.1 drwxr-xr-x 2 root root 4096 Apr 18 2022 home lrwxrwxrwx 1 root root 7 Apr 9 2026 lib -> usr/lib lrwxrwxrwx 1 root root 9 Apr 9 2026 lib32 -> usr/lib32 lrwxrwxrwx 1 root root 9 Apr 9 2026 lib64 -> usr/lib64 lrwxrwxrwx 1 root root 10 Apr 9 2026 libx32 -> usr/libx32 -rwxr-xr-x 1 root root 26927256 Jul 22 16:42 mc drwxr-xr-x 2 root root 4096 Apr 9 2026 media drwxr-x--- 2 root root 4096 Oct 30 10:15 metadata drwxr-x--- 2 root root 4096 Oct 30 10:15 metadata_dropped -rwxr-xr-x 1 root root 103174296 Jul 22 16:42 minio drwxr-xr-x 4 root root 4096 Oct 30 09:49 minio_data drwxr-xr-x 2 root root 4096 Apr 9 2026 mnt drwxr-xr-x 1 root root 4096 May 6 08:02 opt -rw-r--r-- 1 root root 0 Mar 24 2026 .package-cache-mutate drwxrwxr-x 2 1000 1000 4096 Oct 30 09:48 package_folder drwxr-x--- 2 root root 4096 Oct 30 10:16 preprocessed_configs dr-xr-xr-x 315 root root 0 Oct 30 09:48 proc -rwxrwxr-x 1 root root 10295 May 6 08:01 process_functional_tests_result.py -rw-r--r-- 1 root root 29 Oct 30 10:00 queries_02352 -rw-r----- 1 root root 1 Oct 30 10:15 quotas.list -rw-rw-r-- 1 root root 837 Jul 22 16:40 requirements.txt -rw-r----- 1 root root 1 Oct 30 10:15 roles.list drwx------ 1 root root 4096 Oct 30 10:26 root -rw-r----- 1 root root 1 Oct 30 10:15 row_policies.list drwxr-xr-x 1 root root 4096 Oct 30 09:49 run -rwxrwxr-x 1 root root 22124 Jul 22 16:40 run.sh lrwxrwxrwx 1 root root 8 Apr 9 2026 sbin -> usr/sbin -rw-r--r-- 1 root root 747 Oct 30 09:49 script.gdb -rw-r--r-- 1 root root 65482 Oct 30 10:17 server.log -rw-r----- 1 root root 1 Oct 30 10:15 settings_profiles.list -rwxrwxr-x 1 root root 10374 May 6 08:10 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Jul 22 16:40 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3456 Jul 22 16:40 setup_minio.sh drwxr-xr-x 2 root root 4096 Apr 9 2026 srv -rw-r--r-- 1 root root 399 Oct 30 09:58 ssh_key -rw-r----- 1 root root 65 Oct 30 10:16 status drwxr-x--- 4 root root 4096 Oct 30 10:15 store -rw-rw-r-- 1 root root 14032 Jul 22 16:40 stress_tests.lib dr-xr-xr-x 13 root root 0 Oct 30 09:48 sys drwxrwxr-x 2 1000 1000 4096 Oct 30 09:49 test_output drwxrwxrwt 1 root root 4096 Oct 30 10:29 tmp drwxr-x--- 2 root root 4096 Oct 30 10:15 user_files -rw-r----- 1 root root 1 Oct 30 10:15 users.list drwxr-xr-x 1 root root 4096 Apr 9 2026 usr -rw-rw-r-- 1 root root 897 Jul 22 16:40 utils.lib -rw-r----- 1 root root 36 Oct 30 10:15 uuid drwxr-xr-x 1 root root 4096 Apr 9 2026 var + echo 'Files in root directory' + ls -la / Files in root directory total 129436 drwxr-xr-x 1 root root 4096 Oct 30 10:20 . drwxr-xr-x 1 root root 4096 Oct 30 10:20 .. -rw-rw-r-- 1 1000 1000 119 Oct 30 09:45 analyzer_tech_debt.txt -rw-rw-r-- 1 root root 2380 Jul 22 16:40 attach_gdb.lib -rw-r--r-- 1 root root 53 Oct 30 09:49 AzuriteConfig -rw-r--r-- 1 root root 1834 Oct 30 10:14 __azurite_db_blob_extent__.json -rw-r--r-- 1 root root 4241 Oct 30 10:14 __azurite_db_blob__.json -rw-r--r-- 1 root root 2090133 Oct 30 10:29 azurite_log lrwxrwxrwx 1 root root 7 Apr 9 2026 bin -> usr/bin drwxr-xr-x 2 root root 4096 Oct 30 10:29 __blobstorage__ drwxr-xr-x 2 root root 4096 Apr 18 2022 boot -rw-rw-r-- 1 1000 1000 2149 Oct 30 09:45 broken_tests.json drwxr-x--- 4 root root 4096 Oct 30 10:15 data drwxr-xr-x 14 root root 3840 Oct 30 09:48 dev -rwxr-xr-x 1 root root 0 Oct 30 09:48 .dockerenv drwxr-xr-x 1 root root 4096 Oct 30 09:49 etc drwxr-x--- 2 root root 4096 Oct 30 10:15 flags drwxr-x--- 2 root root 4096 Oct 30 10:15 format_schemas drwxr-xr-x 1 1000 1000 4096 Oct 30 09:49 hadoop-3.3.1 drwxr-xr-x 2 root root 4096 Apr 18 2022 home lrwxrwxrwx 1 root root 7 Apr 9 2026 lib -> usr/lib lrwxrwxrwx 1 root root 9 Apr 9 2026 lib32 -> usr/lib32 lrwxrwxrwx 1 root root 9 Apr 9 2026 lib64 -> usr/lib64 lrwxrwxrwx 1 root root 10 Apr 9 2026 libx32 -> usr/libx32 -rwxr-xr-x 1 root root 26927256 Jul 22 16:42 mc drwxr-xr-x 2 root root 4096 Apr 9 2026 media drwxr-x--- 2 root root 4096 Oct 30 10:15 metadata drwxr-x--- 2 root root 4096 Oct 30 10:15 metadata_dropped -rwxr-xr-x 1 root root 103174296 Jul 22 16:42 minio drwxr-xr-x 4 root root 4096 Oct 30 09:49 minio_data drwxr-xr-x 2 root root 4096 Apr 9 2026 mnt drwxr-xr-x 1 root root 4096 May 6 08:02 opt -rw-r--r-- 1 root root 0 Mar 24 2026 .package-cache-mutate drwxrwxr-x 2 1000 1000 4096 Oct 30 09:48 package_folder drwxr-x--- 2 root root 4096 Oct 30 10:16 preprocessed_configs dr-xr-xr-x 315 root root 0 Oct 30 09:48 proc -rwxrwxr-x 1 root root 10295 May 6 08:01 process_functional_tests_result.py -rw-r--r-- 1 root root 29 Oct 30 10:00 queries_02352 -rw-r----- 1 root root 1 Oct 30 10:15 quotas.list -rw-rw-r-- 1 root root 837 Jul 22 16:40 requirements.txt -rw-r----- 1 root root 1 Oct 30 10:15 roles.list drwx------ 1 root root 4096 Oct 30 10:26 root -rw-r----- 1 root root 1 Oct 30 10:15 row_policies.list drwxr-xr-x 1 root root 4096 Oct 30 09:49 run -rwxrwxr-x 1 root root 22124 Jul 22 16:40 run.sh lrwxrwxrwx 1 root root 8 Apr 9 2026 sbin -> usr/sbin -rw-r--r-- 1 root root 747 Oct 30 09:49 script.gdb -rw-r--r-- 1 root root 65482 Oct 30 10:17 server.log -rw-r----- 1 root root 1 Oct 30 10:15 settings_profiles.list -rwxrwxr-x 1 root root 10374 May 6 08:10 setup_export_logs.sh -rwxrwxr-x 1 root root 360 Jul 22 16:40 setup_hdfs_minicluster.sh -rwxrwxr-x 1 root root 3456 Jul 22 16:40 setup_minio.sh drwxr-xr-x 2 root root 4096 Apr 9 2026 srv -rw-r--r-- 1 root root 399 Oct 30 09:58 ssh_key -rw-r----- 1 root root 65 Oct 30 10:16 status drwxr-x--- 4 root root 4096 Oct 30 10:15 store -rw-rw-r-- 1 root root 14032 Jul 22 16:40 stress_tests.lib dr-xr-xr-x 13 root root 0 Oct 30 09:48 sys drwxrwxr-x 2 1000 1000 4096 Oct 30 09:49 test_output drwxrwxrwt 1 root root 4096 Oct 30 10:29 tmp drwxr-x--- 2 root root 4096 Oct 30 10:15 user_files -rw-r----- 1 root root 1 Oct 30 10:15 users.list drwxr-xr-x 1 root root 4096 Apr 9 2026 usr -rw-rw-r-- 1 root root 897 Jul 22 16:40 utils.lib -rw-r----- 1 root root 36 Oct 30 10:15 uuid drwxr-xr-x 1 root root 4096 Apr 9 2026 var + /process_functional_tests_result.py 2026-10-30 10:29:28,296 File /analyzer_tech_debt.txt with broken tests found 2026-10-30 10:29:28,296 File /broken_tests.json with broken tests found 2026-10-30 10:29:28,297 Broken tests in the list: 4 2026-10-30 10:29:28,297 Find files in result folder test_result.txt,gdb.log,run.log,minio.log,hdfs_minicluster.log 2026-10-30 10:29:28,334 Is flaky check: False 2026-10-30 10:29:28,334 Result parsed 2026-10-30 10:29:28,341 Result written + clickhouse-client -q 'system flush logs' + stop_logs_replication + echo 'Detach all logs replication' Detach all logs replication + clickhouse-client --query 'select database||'\''.'\''||table from system.tables where database = '\''system'\'' and (table like '\''%_sender'\'' or table like '\''%_watcher'\'')' + tee /dev/stderr + timeout --preserve-status --signal TERM --kill-after 5m 15m xargs -n1 -r -i clickhouse-client --query 'drop table {}' xargs: warning: options --max-args and --replace/-I/-i are mutually exclusive, ignoring previous --max-args value + failed_to_save_logs=0 + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.query_log into outfile '\''/test_output/query_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.zookeeper_log into outfile '\''/test_output/zookeeper_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.trace_log into outfile '\''/test_output/trace_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.transactions_info_log into outfile '\''/test_output/transactions_info_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.metric_log into outfile '\''/test_output/metric_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.blob_storage_log into outfile '\''/test_output/blob_storage_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + for table in query_log zookeeper_log trace_log transactions_info_log metric_log blob_storage_log error_log + clickhouse-client -q 'select * from system.error_log into outfile '\''/test_output/error_log.tsv.zst'\'' format TSVWithNamesAndTypes' + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + sleep 1 + clickhouse-client -q 'SYSTEM FLUSH ASYNC INSERT QUEUE' + clickhouse-client -q 'SELECT log FROM minio_audit_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_audit_logs.jsonl.zst'\'' FORMAT JSONEachRow' + clickhouse-client -q 'SELECT log FROM minio_server_logs ORDER BY event_time INTO OUTFILE '\''/test_output/minio_server_logs.jsonl.zst'\'' FORMAT JSONEachRow' + sudo clickhouse stop script.gdb:13: Error in sourced command file: No stack. /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 595. The process with pid = 595 is running. Sent terminate signal to process with pid 595. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 595. The process with pid = 595 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 595. The process with pid = 595 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 595. The process with pid = 595 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 595. The process with pid = 595 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 595. The process with pid = 595 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 595. The process with pid = 595 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 595. The process with pid = 595 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 595. The process with pid = 595 is running. Waiting for server to stop /var/run/clickhouse-server/clickhouse-server.pid file exists and contains pid = 595. The process with pid = 595 does not exist. Server stopped + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + kill 1464 + rg -Fa '' /var/log/clickhouse-server/clickhouse-server.log + : + rg -A50 -Fa ============ /var/log/clickhouse-server/stderr.log + : + data_path_config=--path=/var/lib/clickhouse/ + [[ -n '' ]] + '[' 0 -ne 0 ']' + for trace_type in CPU Memory Real + zstd --threads=0 + zstd --threads=0 + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''CPU'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + for trace_type in CPU Memory Real + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''Memory'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + zstd --threads=0 + for trace_type in CPU Memory Real + clickhouse-local --path=/var/lib/clickhouse/ --only-system-tables -q ' select arrayStringConcat((arrayMap(x -> concat(splitByChar('\''/'\'', addressToLine(x))[-1], '\''#'\'', demangle(addressToSymbol(x)) ), trace)), '\'';'\'') AS stack, count(*) AS samples from system.trace_log where trace_type = '\''Real'\'' group by trace order by samples desc settings allow_introspection_functions = 1 format TabSeparated' + zstd --threads=0 + check_logs_for_critical_errors + sed -n '/WARNING:.*anitizer/,/^$/p' /var/log/clickhouse-server/stderr.log + rg -Fav -e 'ASan doesn'\''t fully support makecontext/swapcontext functions' -e DB::Exception /test_output/tmp + echo -e 'No sanitizer asserts\tOK\t\N\t' + rm -f /test_output/tmp + rg -Fa ' Application: Child process was terminated by signal 9' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No OOM messages in clickhouse-server.log\tOK\t\N\t' + rg -Fa 'Code: 49. DB::Exception: ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No logical errors\tOK\t\N\t' + '[' -s /test_output/logical_errors.txt ']' + rm /test_output/logical_errors.txt + rg --text 'Code: 499.*The specified key does not exist' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + grep -v a.myext + echo -e 'No lost s3 keys\tOK\t\N\t' + grep SharedMergeTreePartCheckThread + rg -Fa 'it is lost forever' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No SharedMergeTree lost forever in clickhouse-server.log\tOK\t\N\t' + '[' -s /test_output/no_such_key_errors.txt ']' + rm /test_output/no_such_key_errors.txt + rg -Fa '########################################' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'Not crashed\tOK\t\N\t' + rg -Fa ' ' /var/log/clickhouse-server/clickhouse-server.err.log /var/log/clickhouse-server/clickhouse-server.log + echo -e 'No fatal messages in clickhouse-server.log\tOK\t\N\t' + '[' -s /test_output/fatal_messages.txt ']' + rm /test_output/fatal_messages.txt + rg -v 'rg -Fa' + rg -Faz '########################################' /test_output/blob_storage_log.tsv.zst /test_output/check_status.tsv /test_output/clickhouse-server.log.zst /test_output/error_log.tsv.zst /test_output/gdb.log /test_output/hdfs_minicluster.log /test_output/metric_log.tsv.zst /test_output/minio_audit_logs.jsonl.zst /test_output/minio.log /test_output/minio_server_logs.jsonl.zst /test_output/query_log.tsv.zst /test_output/run.log /test_output/test_results.tsv /test_output/test_result.txt /test_output/trace-log-CPU-flamegraph.tsv.zst /test_output/trace-log-Memory-flamegraph.tsv.zst /test_output/trace-log-Real-flamegraph.tsv.zst /test_output/trace_log.tsv.zst /test_output/transactions_info_log.tsv.zst /test_output/zookeeper_log.tsv.zst + rg -Fa ' received signal ' /test_output/gdb.log + dmesg -T + grep -q -F -e 'Out of memory: Killed process' -e 'oom_reaper: reaped process' -e oom-kill:constraint=CONSTRAINT_NONE /test_output/dmesg.log + echo -e 'No OOM in dmesg\tOK\t\N\t' + rm /var/log/clickhouse-server/clickhouse-server.log + mv /var/log/clickhouse-server/stderr.log /test_output/ + [[ -n '' ]] + tar -chf /test_output/coordination.tar /var/lib/clickhouse/coordination tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + rm -rf /var/lib/clickhouse/data/system/asynchronous_insert_log/ /var/lib/clickhouse/data/system/asynchronous_metric_log/ /var/lib/clickhouse/data/system/backup_log/ /var/lib/clickhouse/data/system/blob_storage_log/ /var/lib/clickhouse/data/system/crash_log/ /var/lib/clickhouse/data/system/error_log/ /var/lib/clickhouse/data/system/filesystem_cache_log/ /var/lib/clickhouse/data/system/metric_log/ /var/lib/clickhouse/data/system/opentelemetry_span_log/ /var/lib/clickhouse/data/system/part_log/ /var/lib/clickhouse/data/system/processors_profile_log/ /var/lib/clickhouse/data/system/query_log/ /var/lib/clickhouse/data/system/query_thread_log/ /var/lib/clickhouse/data/system/query_views_log/ /var/lib/clickhouse/data/system/s3queue_log/ /var/lib/clickhouse/data/system/session_log/ /var/lib/clickhouse/data/system/text_log/ /var/lib/clickhouse/data/system/trace_log/ /var/lib/clickhouse/data/system/transactions_info_log/ /var/lib/clickhouse/data/system/zookeeper_log/ + tar -chf /test_output/store.tar /var/lib/clickhouse/store tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + tar -chf /test_output/metadata.tar /var/lib/clickhouse/metadata/03147_db.sql /var/lib/clickhouse/metadata/default.sql /var/lib/clickhouse/metadata/empty_db_01036.sql /var/lib/clickhouse/metadata/information_schema.sql /var/lib/clickhouse/metadata/INFORMATION_SCHEMA.sql /var/lib/clickhouse/metadata/system.sql /var/lib/clickhouse/metadata/test_7znjktym_1.sql /var/lib/clickhouse/metadata/test_b8rz91wh.sql /var/lib/clickhouse/metadata/test_fwxj6568.sql /var/lib/clickhouse/metadata/test.sql /var/lib/clickhouse/metadata/test_vhfypo2j.sql tar: Removing leading `/' from member names tar: Removing leading `/' from hard link targets + [[ 0 -eq 1 ]] + [[ 0 -eq 1 ]] + collect_core_dumps + find . -type f -maxdepth 1 -name 'core.*' + read -r core